Glyma17g22640 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g22640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g22640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g22640

Feature Type:	gene_model
Chromosome:	Gm17
Start:	22405711
stop:	22406288
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g22640

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G70310	AT	Annotation by Michelle Graham. TAIR10: spermidine synthase 2 \| chr1:26485497-26487352 REVERSE LENGTH=340	SoyBase	E_val: 9.00E-37	ISS
GO:0000096	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process	SoyBase	N/A	ISS
GO:0008295	GO-bp	Annotation by Michelle Graham. GO Biological Process: spermidine biosynthetic process	SoyBase	N/A	ISS
GO:0008652	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0009069	GO-bp	Annotation by Michelle Graham. GO Biological Process: serine family amino acid metabolic process	SoyBase	N/A	ISS
GO:0009616	GO-bp	Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing	SoyBase	N/A	ISS
GO:0010050	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative phase change	SoyBase	N/A	ISS
GO:0042545	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall modification	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004766	GO-mf	Annotation by Michelle Graham. GO Molecular Function: spermidine synthase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR11558	Panther	SPERMIDINE SYNTHASE	JGI		ISS
PTHR11558:SF11	Panther	PUTRESCINE N-METHYLTRANSFERASE	JGI		ISS
PF01564	PFAM	Spermine/spermidine synthase	JGI		ISS
UniRef100_C6THA0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6THA0_SOYBN	SoyBase	E_val: 1.00E-39	ISS
UniRef100_Q0VIL9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Spermidine synthase (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q0VIL9_PHAVU	SoyBase	E_val: 2.00E-38	ISS

Expression Patterns of Glyma17g22640

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g22640 not represented in the dataset	Glyma17g22640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g22640 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma17g22640

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g22640

Limit To All Plant Sequences

>Glyma17g22640.1   sequence type=CDS   gene model=Glyma17g22640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTTTGGTTATTGGTGGAGGAGATGGTGGAGTCCTGCGGGAAGTAGCTCGTCATTCCTCAGTAGAGAAGATAGACATTTTTGAAATAGACAAGATGGTTGTCGAAGTCTCTAAACAATTTTTCCCTGATATAGCAGTAGGTTTTGAGGACCCACATGTAACACTTACTGTTGGTGATGGAGTTGCATTCTTGAAGAATGTTCCAAAAGGAACTTACGATGCAGTTATA

Predicted protein sequences of Glyma17g22640

Limit To All Plant Sequences

>Glyma17g22640.1   sequence type=predicted peptide   gene model=Glyma17g22640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VLVIGGGDGGVLREVARHSSVEKIDIFEIDKMVVEVSKQFFPDIAVGFEDPHVTLTVGDGVAFLKNVPKGTYDAVI

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain