SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g22601

Feature Type:gene_model
Chromosome:Gm17
Start:22262881
stop:22265161
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g22601
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G21650AT Annotation by Michelle Graham. TAIR10: Preprotein translocase SecA family protein | chr1:7592891-7600590 REVERSE LENGTH=1058 SoyBaseE_val: 3.00E-24ISS
GO:0006605GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0017038GO-bp Annotation by Michelle Graham. GO Biological Process: protein import SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_I1KAE1UniRef Annotation by Michelle Graham. Best UniRef hit: Protein translocase subunit SecA 4 n=1 Tax=Glycine max RepID=I1KAE1_SOYBN SoyBaseE_val: 1.00E-27ISS
UniRef100_I1KAE1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein translocase subunit SecA 4 n=1 Tax=Glycine max RepID=I1KAE1_SOYBN SoyBaseE_val: 1.00E-27ISS

Expression Patterns of Glyma17g22601
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g22601 not represented in the dataset
Glyma17g22601 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g22601 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g22601
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g22601
>Glyma17g22601.1   sequence type=CDS   gene model=Glyma17g22601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTAGACAAGGTCATCCTGTCTTAGTTGGAACAACTAGCGTAGAAAATTCAGAACTTTTGTCTGGTCTGCTTAGGGAATGGAATATTCCTCATAATGTTCTAAATGCTAGACCCAAGTATGCAGCAAAAGAAGCTGAAATTGTTGCTCAAGCAGGACGGAAATCCAAAATTAGATGTTCCTGGTTTCCACCATCTACGAAACCCACTTTCAACATCGGTGCTGACGTAAGTACCGATGTTGAAATACTAACTTACAAAGACGTTCATGGATTTCCACCGTCTACGAAACCCGCGATTTCTACATCGGTCAACCGTAGCAACGACTTAAAAAATGCACTGTTTTACATCTGGCACAGCTTAACAAAGGATGTTGAATGA
Predicted protein sequences of Glyma17g22601
>Glyma17g22601.1   sequence type=predicted peptide   gene model=Glyma17g22601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFRQGHPVLVGTTSVENSELLSGLLREWNIPHNVLNARPKYAAKEAEIVAQAGRKSKIRCSWFPPSTKPTFNIGADVSTDVEILTYKDVHGFPPSTKPAISTSVNRSNDLKNALFYIWHSLTKDVE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo