|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G76650 | AT | Annotation by Michelle Graham. TAIR10: calmodulin-like 38 | chr1:28766909-28767442 REVERSE LENGTH=177 | SoyBase | E_val: 1.00E-16 | ISS |
| GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
| GO:0009620 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fungus | SoyBase | N/A | ISS |
| GO:0009695 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009723 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus | SoyBase | N/A | ISS |
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009753 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus | SoyBase | N/A | ISS |
| GO:0009873 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0035556 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0005509 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calcium ion binding | SoyBase | N/A | ISS |
| PTHR10891 | Panther | CALMODULIN | JGI | ISS | |
| PTHR10891:SF141 | Panther | CALCIUM-BINDING PROTEIN | JGI | ISS | |
| PF00036 | PFAM | EF hand | JGI | ISS | |
| UniRef100_G7J5J1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin-like protein n=2 Tax=Medicago truncatula RepID=G7J5J1_MEDTR | SoyBase | E_val: 4.00E-30 | ISS |
| UniRef100_I1MW34 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MW34_SOYBN | SoyBase | E_val: 2.00E-44 | ISS |
|
Glyma17g22580 not represented in the dataset |
Glyma17g22580 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma17g22580.1 sequence type=CDS gene model=Glyma17g22580 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAATTTGGGGGAGAGGAGCAGAAGTTGAATGACTTGAAGGTAACTTTTGACATGTGTGACACTGAAAGCTGTGGGTTTATAACCCCTGAGATCTTGAAAAAGATGCTTAAGAAGATGGGTGAGTCCAAATCCATTGATGAGTGCAAATCTATGATCAAACAATTTGATTTGAATGGGGATGGTGTCCTAAGCTTTGAAGAATTCAGAATTATGATGCAGTGA
>Glyma17g22580.1 sequence type=predicted peptide gene model=Glyma17g22580 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEFGGEEQKLNDLKVTFDMCDTESCGFITPEILKKMLKKMGESKSIDECKSMIKQFDLNGDGVLSFEEFRIMMQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||