SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g22453

Feature Type:gene_model
Chromosome:Gm17
Start:22028308
stop:22028592
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g22453
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G24910AT Annotation by Michelle Graham. TAIR10: cytochrome P450, family 714, subfamily A, polypeptide 1 | chr5:8567674-8570260 REVERSE LENGTH=532 SoyBaseE_val: 2.00E-27ISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
UniRef100_G7J9R2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 n=1 Tax=Medicago truncatula RepID=G7J9R2_MEDTR SoyBaseE_val: 4.00E-35ISS
UniRef100_I1MW32UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MW32_SOYBN SoyBaseE_val: 3.00E-60ISS

Expression Patterns of Glyma17g22453
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g22453 not represented in the dataset
Glyma17g22453 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g22453 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g22453
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g22453
>Glyma17g22453.1   sequence type=CDS   gene model=Glyma17g22453   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAACTGGTTTTTTCAGTTGTTGTTGTGGGGATTCTAAGCTGGATTCTTTCTGTGTATGGTAATTTGTGGCATGAGTCTCAAAGGGTGAGGAAGAGGCTACAAATGCAAGGTATAAAAGGGCCTCCACCTTCTTTTCTACATTGGAATCTGCCTAATATGCAAAGAATTCAATCTCAGACCAAAGCTGATTCCACTTTCAACTCCAACCATTCTGATCAGTTCCTAGCACATGACTACACTACAACCCTCTTCCCCTATTTTGAACACTGGAGGAAACAATAT
Predicted protein sequences of Glyma17g22453
>Glyma17g22453.1   sequence type=predicted peptide   gene model=Glyma17g22453   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLVFSVVVVGILSWILSVYGNLWHESQRVRKRLQMQGIKGPPPSFLHWNLPNMQRIQSQTKADSTFNSNHSDQFLAHDYTTTLFPYFEHWRKQY






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo