SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g22161

Feature Type:gene_model
Chromosome:Gm17
Start:21809617
stop:21810644
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g22161
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G07090AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S4 (RPS4A) family protein | chr5:2202783-2203805 FORWARD LENGTH=244 SoyBaseE_val: 3.00E-80ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR11581Panther 30S/40S RIBOSOMAL PROTEIN S4 JGI ISS
PF00467PFAM KOW motif JGI ISS
PF00900PFAM Ribosomal family S4e JGI ISS
UniRef100_B9RPJ9UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S4, putative n=1 Tax=Ricinus communis RepID=B9RPJ9_RICCO SoyBaseE_val: 1.00E-80ISS
UniRef100_UPI000233E3D3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E3D3 related cluster n=1 Tax=unknown RepID=UPI000233E3D3 SoyBaseE_val: 2.00E-124ISS

Expression Patterns of Glyma17g22161
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g22161 not represented in the dataset
Glyma17g22161 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g22161 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g22161
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g22161
>Glyma17g22161.1   sequence type=CDS   gene model=Glyma17g22161   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTCTTTTTATCTCTATACAGATGCTGTTTCAATCCCAAAAACAAATGAGAACTTCCGCCTGCTCTATGACACTAAAGGCCGATTCCGTCTTCATTCCATCAGGGATGATGAGGCAAAGTTCAAGCTCTGCAAGGTTAGGTCAGTGCAGTTTGGCCCGAAAGGTATCCCATACCTAAACACCTATGATGGTCGCACCTCCATTACCCGAACCCTCTCATCAGGGCTAATGACACTGTTAAGCTGGATCTGGAGGAAAACAAGATTGTCAATTTTTATCAAATTTGATGTTGGGAATGTAGTTATGGTAACAGGTGGAAGAAACAGGGGGCGTGTTGGAGTGATTAAGAATAGGGAGAAGCATAAGGGTAGCTTTCATGTGCAAGATGCCACTGGGCATGAATTTGCTACTTGTATGGGCAATGTGTTCACTATTGGCAAGGGGACAAAGCCATGGATATCCCTGCCCAAGGGTAAGGGTATTAAGCTGGGTTCAAATTCTGTTAACATTCATGTTCCTATAGATTGTAGTCCTAAAGGGATGTTGGTTGAGATGAACACTCAGTGTGCACATGCAGACAATGGATGTGGAAGTTGCAGTTGTGAAGATAATGCCATGAATGAGCCTATACTTAATAGCAAACTTGAAGCTGTAACATATGTATGA
Predicted protein sequences of Glyma17g22161
>Glyma17g22161.1   sequence type=predicted peptide   gene model=Glyma17g22161   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MISFYLYTDAVSIPKTNENFRLLYDTKGRFRLHSIRDDEAKFKLCKVRSVQFGPKGIPYLNTYDGRTSITRTLSSGLMTLLSWIWRKTRLSIFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFHVQDATGHEFATCMGNVFTIGKGTKPWISLPKGKGIKLGSNSVNIHVPIDCSPKGMLVEMNTQCAHADNGCGSCSCEDNAMNEPILNSKLEAVTYV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo