SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g22121

Feature Type:gene_model
Chromosome:Gm17
Start:21769501
stop:21769967
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g22121
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04580AT Annotation by Michelle Graham. TAIR10: Signal transduction histidine kinase, hybrid-type, ethylene sensor | chr3:1235576-1237965 REVERSE LENGTH=766 SoyBaseE_val: 5.00E-48ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010105GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of ethylene mediated signaling pathway SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0000155GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay sensor kinase activity SoyBaseN/AISS
GO:0000156GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity SoyBaseN/AISS
GO:0004673GO-mf Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0051740GO-mf Annotation by Michelle Graham. GO Molecular Function: ethylene binding SoyBaseN/AISS
UniRef100_G7L2X0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene receptor n=1 Tax=Medicago truncatula RepID=G7L2X0_MEDTR SoyBaseE_val: 8.00E-63ISS
UniRef100_I1NCE1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NCE1_SOYBN SoyBaseE_val: 3.00E-70ISS

Expression Patterns of Glyma17g22121
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g22121 not represented in the dataset
Glyma17g22121 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g22121 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g181400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g22121
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g22121
>Glyma17g22121.1   sequence type=CDS   gene model=Glyma17g22121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGAGGTTTGATTCTTTTGTTGTTCTTGTTGTTGGTTATGGTGCTTTCTGTTTATTCCAACGAAGTGGAATATTCACACATCCATAATGTGCTGGTTTGTCAAAAAGTGAGTGACTTTTTCATTGCCATTGCATATTTTTCGATACCCCTTGAGCTTCTTTACTTTGTGAGCTGCTCCAATGTCCCCTTTAAATTGGTCTTCCTTCAATTCATTGCCTTCATAGTTCTCTGTGGATTGAACCATTTGCTCAATGCCTATACTTACTATGGCCGTCACTCTTTCCAGTTGTTTCTTTCTATTACTATTGCTAAGTTCCTCACTGCTCTTGTTTCTTGTGCCACTGCAATTTCCTTTCCCACACTCATTCCTCTTTTGCTGAAAATCAAAGTGAGGGAGCTATTTTTCTGGCAGAATGTGTTGGAATTGGGCTAA
Predicted protein sequences of Glyma17g22121
>Glyma17g22121.1   sequence type=predicted peptide   gene model=Glyma17g22121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MERGLILLLFLLLVMVLSVYSNEVEYSHIHNVLVCQKVSDFFIAIAYFSIPLELLYFVSCSNVPFKLVFLQFIAFIVLCGLNHLLNAYTYYGRHSFQLFLSITIAKFLTALVSCATAISFPTLIPLLLKIKVRELFFWQNVLELG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo