Glyma17g22080 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g22080

Feature Type:	gene_model
Chromosome:	Gm17
Start:	21694673
stop:	21695097
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g22080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G03360	AT	Annotation by Michelle Graham. TAIR10: ribosomal RNA processing 4 \| chr1:824653-826179 FORWARD LENGTH=322	SoyBase	E_val: 9.00E-37	ISS
GO:0009561	GO-bp	Annotation by Michelle Graham. GO Biological Process: megagametogenesis	SoyBase	N/A	ISS
GO:0004527	GO-mf	Annotation by Michelle Graham. GO Molecular Function: exonuclease activity	SoyBase	N/A	ISS
PTHR21321	Panther	PNAS-3 RELATED	JGI		ISS
PTHR21321:SF2	Panther	RRP4	JGI		ISS
UniRef100_B7FL19	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Exosome complex exonuclease RRP4 n=1 Tax=Medicago truncatula RepID=B7FL19_MEDTR	SoyBase	E_val: 6.00E-39	ISS
UniRef100_I1N9E1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N9E1_SOYBN	SoyBase	E_val: 5.00E-43	ISS

Expression Patterns of Glyma17g22080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g22080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g181200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g22080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g22080

Limit To All Plant Sequences

>Glyma17g22080.1   sequence type=CDS   gene model=Glyma17g22080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGCGTCCTCAAGGGTCACGAAACTGCCGACCTCAACGGCGAAGTCGTTGCCACCCTCTGCGGCGTCGTAGAGCACATCAACAAACTTGTCTACGTTCGCGCGTTACGCTCCAAATATAAACCTGAGGTTGGTGACATTGTTATAGGGCGTGTTGTTGAGGTTGCTCAGAAGTGTTGGCGATTGGAGATAAATTACAACCAGGATGCAGTTTTGCTGCTTTCTTCTATGAACATGCGTGATGGT

Predicted protein sequences of Glyma17g22080

Limit To All Plant Sequences

>Glyma17g22080.1   sequence type=predicted peptide   gene model=Glyma17g22080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GVLKGHETADLNGEVVATLCGVVEHINKLVYVRALRSKYKPEVGDIVIGRVVEVAQKCWRLEINYNQDAVLLLSSMNMRDG

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain