SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g21590

Feature Type:gene_model
Chromosome:Gm17
Start:21081304
stop:21085583
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g21590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G66930AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1649 (InterPro:IPR012445); Has 251 Blast hits to 251 proteins in 113 species: Archae - 0; Bacteria - 0; Metazoa - 91; Fungi - 85; Plants - 58; Viruses - 0; Other Eukaryotes - 17 (source: NCBI BLink). | chr5:26725997-26727549 FORWARD LENGTH=215 SoyBaseE_val: 1.00E-119ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4493 KOG Uncharacterized conserved protein JGI ISS
PTHR13292Panther UNCHARACTERIZED JGI ISS
PF07855PFAM Protein of unknown function (DUF1649) JGI ISS
UniRef100_G7LFM8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Meiotically up-regulated gene 66 protein n=1 Tax=Medicago truncatula RepID=G7LFM8_MEDTR SoyBaseE_val: 1.00E-120ISS
UniRef100_I1MW22UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MW22_SOYBN SoyBaseE_val: 9.00E-161ISS

Expression Patterns of Glyma17g21590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g21590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g180900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g21590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g21590
>Glyma17g21590.1   sequence type=CDS   gene model=Glyma17g21590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACTGTGAAGTGTGCCAGCTCAAGGAACTGGAACTGGAGCATTTTGAGATACGCGAGGTCTTGCGATGCATATTGCACACGATCGTCTTTCACCGTGCCTTGGGTCTCGTGCGCCCTAAAGACGTTGACTTGGAGCTATTTGACGTCACTTATGTGCAATGTGGAGAGGCAGAGCTTGAAAAGAAAATAGATGAGAAGATTGAGCAGTTTGTTTGTTGGGTGGAGAAGCACCCAAACAAGAAGAGTCAGATATGTTTATCTTTCTATGAGGTGAAGAACAAACAGGCGTCTTGGTTCAGTAACAAGATTGAACGTTTGTATTGGGAGCAGTGGTATATTAATCTGAATGTGGCCCAGCATCCGAAGGCACATTCTAGCAAGTATCATCATTCCAAAGTTGTTGATCCTGGAGAGGGAGCATTGGAGGATAGAAATGCTCGAAGTGCAGCACTGGAGGCATCGCTTCGTGAGGTTTTATTTCAGATAATTAAATTTGTTAATGAGAAGAAGGATCATGTTCCACCTATACCAAATCTTGAGGGTGCTGTTTCATTTCCCTATGAAATTACAATCCCTAGTTCATCAGATTCTGCATTTGGGATGGACATGATCAAGAGAATGCTACAGACAGGACATCCAACAATGCTAAGTTGA
Predicted protein sequences of Glyma17g21590
>Glyma17g21590.1   sequence type=predicted peptide   gene model=Glyma17g21590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNCEVCQLKELELEHFEIREVLRCILHTIVFHRALGLVRPKDVDLELFDVTYVQCGEAELEKKIDEKIEQFVCWVEKHPNKKSQICLSFYEVKNKQASWFSNKIERLYWEQWYINLNVAQHPKAHSSKYHHSKVVDPGEGALEDRNARSAALEASLREVLFQIIKFVNEKKDHVPPIPNLEGAVSFPYEITIPSSSDSAFGMDMIKRMLQTGHPTMLS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo