SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g21556

Feature Type:gene_model
Chromosome:Gm17
Start:20993913
stop:20994780
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g21556
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24820AT Annotation by Michelle Graham. TAIR10: 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain | chr4:12790471-12792599 REVERSE LENGTH=387 SoyBaseE_val: 1.00E-91ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0030163GO-bp Annotation by Michelle Graham. GO Biological Process: protein catabolic process SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051604GO-bp Annotation by Michelle Graham. GO Biological Process: protein maturation SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0008541GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, lid subcomplex SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR14145Panther 26S PROTESOME SUBUNIT 6 JGI ISS
PTHR14145:SF1Panther 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 6 JGI ISS
PF10602PFAM 26S proteasome subunit RPN7 JGI ISS
UniRef100_E5GBW6UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26S proteasome non-ATPase regulatory subunit n=1 Tax=Cucumis melo subsp. melo RepID=E5GBW6_CUCME SoyBaseE_val: 5.00E-92ISS
UniRef100_I1MW21UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MW21_SOYBN SoyBaseE_val: 2.00E-104ISS

Expression Patterns of Glyma17g21556
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g21556 not represented in the dataset
Glyma17g21556 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g21556 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g180700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g21556
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g21556
>Glyma17g21556.1   sequence type=CDS   gene model=Glyma17g21556   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACAGAGGAAAACTTAGGTGAGAGTGAAGTTTGTGAGGCTCACTTGGTAAAATCCTTGTTTTTCATTCGGATTATGGACAAAGAGAAAGCCTTGGAACATCTCAAGGTAACAAAAACCAAGATAGTTGTAGTTGGCCAAAAAATGGACTTGGTGTTTTATACATTGCAACTTGGTTTCTTTGACATGGATTTTGATCTCATTTCCAAAAGCATTGACAAAGCCAAAAAGAAGAATAGGTTGGAAGTGTATGAAGGCTTGTATTTCATGTCCACTCGAAATTTCAAGAAGGCTGCCAAGCTGTTTTTGGGTTCTATTTCAACCTTTACCACCTATGAAGTTTTTCCCTGTGACACCTTTATATTATATACAGTTTTGACCATCATTATATCATTGGATAGAGTTTCCCTAAAGCAAAAGGTAGTAGATTCTCCAAAGATCTTGACAATGATTGGCAAAATCCCATATCTTTCAGAGTTTTTGAACTCCTTATATGATTGTCAATACAAGTCTTTTTTTCTCAGCATTTGGTGA
Predicted protein sequences of Glyma17g21556
>Glyma17g21556.1   sequence type=predicted peptide   gene model=Glyma17g21556   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TEENLGESEVCEAHLVKSLFFIRIMDKEKALEHLKVTKTKIVVVGQKMDLVFYTLQLGFFDMDFDLISKSIDKAKKKNRLEVYEGLYFMSTRNFKKAAKLFLGSISTFTTYEVFPCDTFILYTVLTIIISLDRVSLKQKVVDSPKILTMIGKIPYLSEFLNSLYDCQYKSFFLSIW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo