Glyma17g21180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g21180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g21180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g21180

Feature Type:	gene_model
Chromosome:	Gm17
Start:	20421201
stop:	20421821
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g21180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G26930	AT	Annotation by Michelle Graham. TAIR10: 4-(cytidine 5'-phospho)-2-C-methyl-D-erithritol kinase \| chr2:11491829-11494229 REVERSE LENGTH=383	SoyBase	E_val: 9.00E-60	ISS
GO:0006783	GO-bp	Annotation by Michelle Graham. GO Biological Process: heme biosynthetic process	SoyBase	N/A	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0010114	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to red light	SoyBase	N/A	ISS
GO:0010155	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of proton transport	SoyBase	N/A	ISS
GO:0010218	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to far red light	SoyBase	N/A	ISS
GO:0016114	GO-bp	Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0050515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity	SoyBase	N/A	ISS
PTHR20861	Panther	HOMOSERINE/4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE	JGI		ISS
PTHR20861:SF2	Panther	4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE	JGI		ISS
PF00288	PFAM	GHMP kinases N terminal domain	JGI		ISS
UniRef100_H8ZW92	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Isopentenyl monophosphate kinase (Fragment) n=1 Tax=Satureja montana RepID=H8ZW92_SATMO	SoyBase	E_val: 2.00E-64	ISS
UniRef100_I1NE02	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NE02_SOYBN	SoyBase	E_val: 6.00E-72	ISS

Expression Patterns of Glyma17g21180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g21180 not represented in the dataset	Glyma17g21180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g21180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma17g21180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g21180

Limit To All Plant Sequences

>Glyma17g21180.1   sequence type=CDS   gene model=Glyma17g21180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGTCTTACTTGAATCTTTTGAGTCTTCAGGTGATAAGTCTAGGTGACATAATTAAGTTCTCTTTGTCACCTTCAAAAACCAAGGATAGCCTGTCAACCAACGTGTCTGGGGTGCCCCTTGATGATAGAAATTTGGCACTAAATCTTTATAGGAAGAAGACTGGAAGTGACAAGTACTTTGGGATTCATCTTGATAAATGGGTGCCTACTGGGGCAGGGCTTGGCGGTGGAAGTAGCAATGCTGCAACTGCACTATGGGCAGCAAATCAATTTAGTGGTTGTCCTGCCTCTGAGAAAGAACTCCAAGAATGGTCAAGTGAGATTGGATCAGATATTCCCTTCTTTTTCTCTCAGGGAGCAGCCTATTACACTGGTCGAGGAGAG

Predicted protein sequences of Glyma17g21180

Limit To All Plant Sequences

>Glyma17g21180.1   sequence type=predicted peptide   gene model=Glyma17g21180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VSYLNLLSLQVISLGDIIKFSLSPSKTKDSLSTNVSGVPLDDRNLALNLYRKKTGSDKYFGIHLDKWVPTGAGLGGGSSNAATALWAANQFSGCPASEKELQEWSSEIGSDIPFFFSQGAAYYTGRGE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain