SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g21180

Feature Type:gene_model
Chromosome:Gm17
Start:20421201
stop:20421821
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g21180
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26930AT Annotation by Michelle Graham. TAIR10: 4-(cytidine 5'-phospho)-2-C-methyl-D-erithritol kinase | chr2:11491829-11494229 REVERSE LENGTH=383 SoyBaseE_val: 9.00E-60ISS
GO:0006783GO-bp Annotation by Michelle Graham. GO Biological Process: heme biosynthetic process SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0016114GO-bp Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0050515GO-mf Annotation by Michelle Graham. GO Molecular Function: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity SoyBaseN/AISS
PTHR20861Panther HOMOSERINE/4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE JGI ISS
PTHR20861:SF2Panther 4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE JGI ISS
PF00288PFAM GHMP kinases N terminal domain JGI ISS
UniRef100_H8ZW92UniRef Annotation by Michelle Graham. Most informative UniRef hit: Isopentenyl monophosphate kinase (Fragment) n=1 Tax=Satureja montana RepID=H8ZW92_SATMO SoyBaseE_val: 2.00E-64ISS
UniRef100_I1NE02UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NE02_SOYBN SoyBaseE_val: 6.00E-72ISS

Expression Patterns of Glyma17g21180
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g21180 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g21180
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g21180
>Glyma17g21180.1   sequence type=CDS   gene model=Glyma17g21180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGTCTTACTTGAATCTTTTGAGTCTTCAGGTGATAAGTCTAGGTGACATAATTAAGTTCTCTTTGTCACCTTCAAAAACCAAGGATAGCCTGTCAACCAACGTGTCTGGGGTGCCCCTTGATGATAGAAATTTGGCACTAAATCTTTATAGGAAGAAGACTGGAAGTGACAAGTACTTTGGGATTCATCTTGATAAATGGGTGCCTACTGGGGCAGGGCTTGGCGGTGGAAGTAGCAATGCTGCAACTGCACTATGGGCAGCAAATCAATTTAGTGGTTGTCCTGCCTCTGAGAAAGAACTCCAAGAATGGTCAAGTGAGATTGGATCAGATATTCCCTTCTTTTTCTCTCAGGGAGCAGCCTATTACACTGGTCGAGGAGAG
Predicted protein sequences of Glyma17g21180
>Glyma17g21180.1   sequence type=predicted peptide   gene model=Glyma17g21180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VSYLNLLSLQVISLGDIIKFSLSPSKTKDSLSTNVSGVPLDDRNLALNLYRKKTGSDKYFGIHLDKWVPTGAGLGGGSSNAATALWAANQFSGCPASEKELQEWSSEIGSDIPFFFSQGAAYYTGRGE






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo