SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g20770

Feature Type:gene_model
Chromosome:Gm17
Start:19844171
stop:19845334
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g20770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G51660AT Annotation by Michelle Graham. TAIR10: cleavage and polyadenylation specificity factor 160 | chr5:20980250-20989268 FORWARD LENGTH=1442 SoyBaseE_val: 1.00E-24ISS
GO:0006378GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA polyadenylation SoyBaseN/AISS
GO:0006379GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA cleavage SoyBaseN/AISS
GO:0006397GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA processing SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0016570GO-bp Annotation by Michelle Graham. GO Biological Process: histone modification SoyBaseN/AISS
GO:0048449GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ formation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_Q9FGR0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cleavage and polyadenylation specificity factor subunit 1 n=1 Tax=Arabidopsis thaliana RepID=CPSF1_ARATH SoyBaseE_val: 5.00E-22ISS
UniRef100_UPI00023388DAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023388DA related cluster n=1 Tax=unknown RepID=UPI00023388DA SoyBaseE_val: 6.00E-25ISS

Expression Patterns of Glyma17g20770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g20770 not represented in the dataset
Glyma17g20770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g20770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g179000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g20770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g20770
>Glyma17g20770.1   sequence type=CDS   gene model=Glyma17g20770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCGCTCTGGTTTTGCAGTTTGGTGTCTTGTTTTTGTCTTCCGTCGAGATGTGCAGAAGTTGCAGCCAAAGTTCTTTGCATTGTTTTGAGGGTCTAGAATGGCTTCATCTGAAAAGAGGAAGAAAACAATTTGCAAGAGGACTAGTGGTAAAGGTTGATCCTCAAGGCAGGTGTGGTGGAGTTCTTATCTATGGTTTGCAAATGATAATACTAAAGGCTACTCAGGTTTATCCTCTCCTTGCAAATTTGAAATTCTTTGTAGTATATGGCACTACTTATTTCCTTTGTAACCTGTTTATTAAAAAAAATCATTAG
Predicted protein sequences of Glyma17g20770
>Glyma17g20770.1   sequence type=predicted peptide   gene model=Glyma17g20770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLALVLQFGVLFLSSVEMCRSCSQSSLHCFEGLEWLHLKRGRKQFARGLVVKVDPQGRCGGVLIYGLQMIILKATQVYPLLANLKFFVVYGTTYFLCNLFIKKNH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo