Glyma17g20473 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g20473

Feature Type:	gene_model
Chromosome:	Gm17
Start:	19504252
stop:	19509795
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g20473

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G66860	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain \| chr5:26701233-26702531 REVERSE LENGTH=249	SoyBase	E_val: 2.00E-73	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
UniRef100_G7LGD1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L25 n=1 Tax=Medicago truncatula RepID=G7LGD1_MEDTR	SoyBase	E_val: 6.00E-90	ISS
UniRef100_I1K1R5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1R5_SOYBN	SoyBase	E_val: 7.00E-102	ISS

Expression Patterns of Glyma17g20473

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g20473 not represented in the dataset	Glyma17g20473 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g20473

Paralog	Evidence	Comments
Glyma05g09970	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g20473 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g178000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g20473

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g20473

Limit To All Plant Sequences

>Glyma17g20473.1   sequence type=CDS   gene model=Glyma17g20473   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACATTCTTCCGGAAGTACTTTGTGGATACTTCCGGAAGTCACAAATTCTTCTTCCGGAAGAAGCCCAGACCGGAACCTAAAACCCCTAACCTCAACTCCGCTGACGCGCCTTTCTTCTGCTCCACGCGCTTCCCGCTCCAGATCCGCGCCGGTTCCGGATCCTCGCATTTGCCCGAATCCGGAACCGTGTTACCTATCAAGATTCATAGGGACGAAGAGAGTGGGAAGATTCTGAATTTGGTGTTTGTTTGGGCTGAGGATGGAATGAAATTGAAGGTGGATGTGCCTGTTGTTTTCAAAGGGGAAGATGCCTGTCCTGGTGTTCAGAAAGGAGGAATTTTGAATAAGATCAGACCTAGTCTAAGATTTCTTTGTCCATCTGAGCACATTCCTTCAAATATTGCTGTGGATGTGAGCAATCTAGATATTGAAGATAGAATATTCATGCGCGATATCGAGGTTCATCCATCTTTGAAGCTTCTCAGTAAGAATGAAAACATGCCCGTATGTAAAATAGTTCCAACAAGTTTGGGAAACAAAGAACCTATTGAGGCGTGA

Predicted protein sequences of Glyma17g20473

Limit To All Plant Sequences

>Glyma17g20473.1   sequence type=predicted peptide   gene model=Glyma17g20473   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTFFRKYFVDTSGSHKFFFRKKPRPEPKTPNLNSADAPFFCSTRFPLQIRAGSGSSHLPESGTVLPIKIHRDEESGKILNLVFVWAEDGMKLKVDVPVVFKGEDACPGVQKGGILNKIRPSLRFLCPSEHIPSNIAVDVSNLDIEDRIFMRDIEVHPSLKLLSKNENMPVCKIVPTSLGNKEPIEA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain