SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g20400

Feature Type:gene_model
Chromosome:Gm17
Start:19408855
stop:19409139
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g20400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G66816AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G50610.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:26681495-26681800 FORWARD LENGTH=101 SoyBaseE_val: 9.00E-15ISS
UniRef100_C6T0H6UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T0H6_SOYBN SoyBaseE_val: 3.00E-41ISS
UniRef100_Q9SKW7UniRef Annotation by Michelle Graham. Most informative UniRef hit: F5J5.3 n=1 Tax=Arabidopsis thaliana RepID=Q9SKW7_ARATH SoyBaseE_val: 2.00E-07ISS

Expression Patterns of Glyma17g20400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g20400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g20400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g20400
>Glyma17g20400.1   sequence type=CDS   gene model=Glyma17g20400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAATCACCACAACACCATGAGGAATCTAGTAAATTGGAAGATTCAGGTGCAGACAACACCAATGCTTTCCGACCGACTACGCCGGGAGGGAGTCCTGGTGTTGGCCACAAAATGATTACATCATCATCAGAAGATAATAAGGGTTCAAAAGATGATTTCAAACCTACTGACCCAGGTCACAGCCCAGGAGTTGGTCATGCTTACAAAAACAAAATTGGAGATGGAAATTAG
Predicted protein sequences of Glyma17g20400
>Glyma17g20400.1   sequence type=predicted peptide   gene model=Glyma17g20400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ESPQHHEESSKLEDSGADNTNAFRPTTPGGSPGVGHKMITSSSEDNKGSKDDFKPTDPGHSPGVGHAYKNKIGDGN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo