SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g20350

Feature Type:gene_model
Chromosome:Gm17
Start:19244464
stop:19244922
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g20350
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G50610AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G66816.1); Has 125 Blast hits to 60 proteins in 16 species: Archae - 0; Bacteria - 2; Metazoa - 10; Fungi - 4; Plants - 97; Viruses - 0; Other Eukaryotes - 12 (source: NCBI BLink). | chr3:18779723-18780412 REVERSE LENGTH=229 SoyBaseE_val: 1.00E-11ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1MVZ6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MVZ6_SOYBN SoyBaseE_val: 2.00E-26ISS

Expression Patterns of Glyma17g20350
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g20350 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g20350
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g20350
>Glyma17g20350.1   sequence type=CDS   gene model=Glyma17g20350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCAGCCTACACAAATGCTTTCCGACCCACAACACCAGGGAACAGTCCTGGTGTTGGTCACCGAAAATTTGCACTAGAAGATAAAGATATGAAAGCAACAACAAAGGTGGTAGTTGAAAGTTCTGATGTTAAAGTTTATGTTACTGAGGGGACAACGACAAACGGTTTCAAACCTACAAACCCAGGTCACAGTCCTGGTGTTGGTCATGATCACCAAAACTAA
Predicted protein sequences of Glyma17g20350
>Glyma17g20350.1   sequence type=predicted peptide   gene model=Glyma17g20350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAAYTNAFRPTTPGNSPGVGHRKFALEDKDMKATTKVVVESSDVKVYVTEGTTTNGFKPTNPGHSPGVGHDHQN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo