SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g20333

Feature Type:gene_model
Chromosome:Gm17
Start:19132638
stop:19133054
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g20333
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G65360AT Annotation by Michelle Graham. TAIR10: Histone superfamily protein | chr5:26120099-26120509 REVERSE LENGTH=136 SoyBaseE_val: 2.00E-68ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
KOG1745 KOG Histones H3 and H4 JGI ISS
PTHR11426Panther HISTONE H3 JGI ISS
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI ISS
UniRef100_B6SYV0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H3 n=1 Tax=Zea mays RepID=B6SYV0_MAIZE SoyBaseE_val: 3.00E-68ISS
UniRef100_UPI0002338138UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338138 related cluster n=1 Tax=unknown RepID=UPI0002338138 SoyBaseE_val: 3.00E-88ISS

Expression Patterns of Glyma17g20333
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g20333 not represented in the dataset
Glyma17g20333 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g20333 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g176600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g20333
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g20333
>Glyma17g20333.1   sequence type=CDS   gene model=Glyma17g20333   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCGTACGAAGCAAACCGCAAGGAAGTCCACCAGAGGAAAAGCTTCGAGAAAGCAACTTGCCACGAAAGCAGCACACAAGTCCGCTCCGGCGACCGGCGGCGTGAAGAAGCCGCACCGTTTCAGGCCAAGTACGGTGGCGCTAAGGGAGATCCGAAAGTACCAAAAGAACACCGAGCTTCTCATAAGGAAGCTTCCTTTCCAAAGACTCGTAAGGGAAATCGCTCAGGACTTCAAGACCAATCTCTACTTCCACAGCAGCGCCGTCTCCACTCTCCAAGAAGCCGTAGAGGCCTACCTCGTTGTGCTCTTCGAGGACACCAACCTCTGCACCATTCACCCAAAAGAGTTACCATTATGCCAAAGGACTGAGGCCTACCTTGTTGGGCTCTTGTTTATTTTCATTGAATATTGA
Predicted protein sequences of Glyma17g20333
>Glyma17g20333.1   sequence type=predicted peptide   gene model=Glyma17g20333   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARTKQTARKSTRGKASRKQLATKAAHKSAPATGGVKKPHRFRPSTVALREIRKYQKNTELLIRKLPFQRLVREIAQDFKTNLYFHSSAVSTLQEAVEAYLVVLFEDTNLCTIHPKELPLCQRTEAYLVGLLFIFIEY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo