Glyma17g20200 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g20200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g20200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g20200

Feature Type:	gene_model
Chromosome:	Gm17
Start:	18709954
stop:	18712007
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g20200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G49620	AT	Annotation by Michelle Graham. TAIR10: Cyclin-dependent kinase inhibitor family protein \| chr1:18365692-18366559 REVERSE LENGTH=195	SoyBase	E_val: 5.00E-17	ISS
GO:0000278	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitotic cell cycle	SoyBase	N/A	ISS
GO:0007050	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell cycle arrest	SoyBase	N/A	ISS
GO:0010440	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal lineage progression	SoyBase	N/A	ISS
GO:0042023	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication	SoyBase	N/A	ISS
GO:0045736	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of cyclin-dependent protein kinase activity	SoyBase	N/A	ISS
GO:0001673	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: male germ cell nucleus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0004861	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase inhibitor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0030332	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cyclin binding	SoyBase	N/A	ISS
PTHR10265	Panther	CYCLIN-DEPENDENT KINASE INHIBITOR	JGI		ISS
PF02234	PFAM	Cyclin-dependent kinase inhibitor	JGI		ISS
UniRef100_I1MVY7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MVY7_SOYBN	SoyBase	E_val: 2.00E-120	ISS
UniRef100_Q6T2Z0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cyclin-dependent kinase inhibitor 2;2 (Fragment) n=1 Tax=Glycine max RepID=Q6T2Z0_SOYBN	SoyBase	E_val: 3.00E-117	ISS

Expression Patterns of Glyma17g20200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g20200 not represented in the dataset	Glyma17g20200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g20200 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g175700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g20200

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g20200

Limit To All Plant Sequences

>Glyma17g20200.1   sequence type=CDS   gene model=Glyma17g20200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGATGGCTCAGGTTAAGGCACGAGCTCGAACTGCATTGGCCATGGCAGCTTCCGCAACTTCACCGAAGAGAAGAAAAATCTCCTTCGTTCAAATCAAGAGTTTGAGCAACGCTACCTCTCCGACGACGGAGGAACGAATCTCCGGCGAATCTCCGGCTTCGTGCTGCTCCAGCAACGGATCCTTCGACAACGAAAACCGAATCATCAAATCCTCAGATCTAGAGGTTGAGAGTGCGCAAGTTGAAACATGGACGTGCAACTGCGGTGAACAACAACAACAAAAAATAAGGAGAGAGATGAGTCTCACGCGCGAGGTGGATTCAACGGAGGAGCATATCACCAAAACCAAATCTCGCTGCGTTCCAACGGAGTCGGAGCTCGAAGATTTCTTCGCTGCTGCGGAGAAAGACATTCAGAAACGCTTCACAGACAAGTATAATTATGATTTTGTGAAGGACATGCCTTTGGAGGGACAATACGAGTGGGTTAAATTGAAGTCATAA

Predicted protein sequences of Glyma17g20200

Limit To All Plant Sequences

>Glyma17g20200.1   sequence type=predicted peptide   gene model=Glyma17g20200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEMAQVKARARTALAMAASATSPKRRKISFVQIKSLSNATSPTTEERISGESPASCCSSNGSFDNENRIIKSSDLEVESAQVETWTCNCGEQQQQKIRREMSLTREVDSTEEHITKTKSRCVPTESELEDFFAAAEKDIQKRFTDKYNYDFVKDMPLEGQYEWVKLKS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain