|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G06290 | AT | Annotation by Michelle Graham. TAIR10: 2-cysteine peroxiredoxin B | chr5:1919380-1921211 FORWARD LENGTH=273 | SoyBase | E_val: 8.00E-31 | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0006098 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0006833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: water transport | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009750 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus | SoyBase | N/A | ISS |
| GO:0009814 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0019761 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0043900 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0010319 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: stromule | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0016209 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: antioxidant activity | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0051920 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: peroxiredoxin activity | SoyBase | N/A | ISS |
| PTHR10681 | Panther | PEROXIREDOXIN | JGI | ISS | |
| PF00578 | PFAM | AhpC/TSA family | JGI | ISS | |
| UniRef100_E2CXH7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Peroxiredoxin (Fragment) n=1 Tax=Jatropha curcas RepID=E2CXH7_9ROSI | SoyBase | E_val: 5.00E-30 | ISS |
| UniRef100_UPI000233E0F3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233E0F3 related cluster n=1 Tax=unknown RepID=UPI000233E0F3 | SoyBase | E_val: 4.00E-45 | ISS |
|
Glyma17g20150 not represented in the dataset |
Glyma17g20150 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.17g175300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma17g20150.1 sequence type=CDS gene model=Glyma17g20150 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTGTCTGTTCTCTCAGTCTGGCTGCAGTCAAAATCAATTTTCATGTTCTTGCACCTTGCATGGATCCAAACAGATAGAAAGTTGGGTGGCCTTGGTGACTTGAATTATCCTTTGATTTCTGATGCCACCAAATTCATATTGAAATCTTATGGTGTTCTCATTCCAGATCAGGGAATTGCATTGAGAGGTTTGTTCATTATTGACAAGGACAGGGTTATTCAACATTTCTCTACAATGAATAAACTTCAGAAGATGGCATTATGTGTATGTTTAGTTATCATTTATCTCAATTTCTGCAGGATTTTTGCTTTTGTTGGATATTTTATTTTTATCCTTTGTAAGATTAAATCATATGTATGGTCTCTTAGTTAA
>Glyma17g20150.1 sequence type=predicted peptide gene model=Glyma17g20150 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLSVLSVWLQSKSIFMFLHLAWIQTDRKLGGLGDLNYPLISDATKFILKSYGVLIPDQGIALRGLFIIDKDRVIQHFSTMNKLQKMALCVCLVIIYLNFCRIFAFVGYFIFILCKIKSYVWSLS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||