Report for Sequence Feature Glyma17g19830
Feature Type: gene_model
Chromosome: Gm17
Start: 18218753
stop: 18220143
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g19830
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G50330 AT
Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr3:18657423-18658118 REVERSE LENGTH=231
SoyBase E_val: 1.00E-47 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0010500 GO-bp
Annotation by Michelle Graham. GO Biological Process: transmitting tissue development
SoyBase N/A ISS
GO:0048462 GO-bp
Annotation by Michelle Graham. GO Biological Process: carpel formation
SoyBase N/A ISS
GO:0080126 GO-bp
Annotation by Michelle Graham. GO Biological Process: ovary septum development
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
PTHR12565 Panther
STEROL REGULATORY ELEMENT-BINDING PROTEIN
JGI ISS
PF00010 PFAM
Helix-loop-helix DNA-binding domain
JGI ISS
UniRef100_G7K6N1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor HEC2 n=1 Tax=Medicago truncatula RepID=G7K6N1_MEDTR
SoyBase E_val: 6.00E-58 ISS
UniRef100_I1MVX1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MVX1_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma17g19830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma17g19830 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g173100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g19830
Coding sequences of Glyma17g19830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g19830.1 sequence type=CDS gene model=Glyma17g19830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATGTGGACATAGTGAAAACTTCCAACAACAACAACAACATGGACGTTATGGCAATGATGATGCAAATGGAAAAGTTCCCCGAATTATTATTCTGCGACGACCCTTTTTATACCACCACACCCACTTACCAAGAAACCGATTTGTTATCAAGTGGAAGAAGCTCCTCATCAACAACCAGCGCTTCCACCCTATTCAACAACAATGTAACAACCACAATTCCACCGACGACAACACCGTCAAATAATGTTGTCCAATTTTCCAACATTGATGACCTTTTCCAACAACAACCACCTATGTCACAGTCCCTTCAACTTCAACCCTACCCTTCTGAAAAGAAGAAGAAGAACAACAACTCGATGGCGGCGATGAGGGAGATGATATTCCGGATAGCGGTGATGCAACCGGTTCACATCGACCCGGAATCCATAAAGCCACCCAAAAGAAGAAACGTGAAGATCTCGAAGGATCCACAGAGCGTGGCGGCGCGGCACCGGAGAGAGAGGATAAGCGAGAGGATAAGGATTCTACAGAGACTGGTCCCTGGCGGCACAAAAATGGACACTGCTTCGATGCTGGACGAGGCTATTCACTACGTCAAGTTCTTGAAGAAACAGGTGCAGACGCTGGAACAAGCAGGGGCAAATAGGTCACCACACAGTAGTAATAATAATAATAATATTCTCAATACTACTCACGTTGTTGGTGCTGTTGGTTTTCCGCTAGGGATGTCTTCTAATTACTCCAATAATATAATTAGTAATGTTGTTAATTATTCTTTGTTGATGAAGGGTGGTTGCCAACCTTGTCAAGTGTTCGGTTCCACTTCTAAACAATTGCTCAGCTAA
Predicted protein sequences of Glyma17g19830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g19830.1 sequence type=predicted peptide gene model=Glyma17g19830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDVDIVKTSNNNNNMDVMAMMMQMEKFPELLFCDDPFYTTTPTYQETDLLSSGRSSSSTTSASTLFNNNVTTTIPPTTTPSNNVVQFSNIDDLFQQQPPMSQSLQLQPYPSEKKKKNNNSMAAMREMIFRIAVMQPVHIDPESIKPPKRRNVKISKDPQSVAARHRRERISERIRILQRLVPGGTKMDTASMLDEAIHYVKFLKKQVQTLEQAGANRSPHSSNNNNNILNTTHVVGAVGFPLGMSSNYSNNIISNVVNYSLLMKGGCQPCQVFGSTSKQLLS*