SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g19771

Feature Type:gene_model
Chromosome:Gm17
Start:18061643
stop:18062743
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g19771
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G18230AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Oligosaccharide biosynthesis protein Alg14 like (InterPro:IPR013969); Has 640 Blast hits to 640 proteins in 277 species: Archae - 4; Bacteria - 281; Metazoa - 94; Fungi - 127; Plants - 57; Viruses - 0; Other Eukaryotes - 77 (source: NCBI BLink). | chr4:10080521-10081710 REVERSE LENGTH SoyBaseE_val: 1.00E-28ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR12154Panther GLYCOSYL TRANSFERASE-RELATED JGI ISS
PF08660PFAM Oligosaccharide biosynthesis protein Alg14 like JGI ISS
UniRef100_Q84R09UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-1,4-N-acetylglucosaminyltransferase n=1 Tax=Arabidopsis thaliana RepID=Q84R09_ARATH SoyBaseE_val: 5.00E-26ISS
UniRef100_UPI000233E0EAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E0EA related cluster n=1 Tax=unknown RepID=UPI000233E0EA SoyBaseE_val: 2.00E-64ISS

Expression Patterns of Glyma17g19771
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g19771 not represented in the dataset
Glyma17g19771 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g19771 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g172800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g19771
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g19771
>Glyma17g19771.1   sequence type=CDS   gene model=Glyma17g19771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGCAATTCCTATTACCTCCAGCTATGCTTCCACCTTTTCTTATTCTGCTGGTGAAGATGTAATTGTCGCTCTGACTGATATCTTGAAGCTACCTCTGATGGATAAAAGCAATGGCTGCAGCTTCTCTAGCATATCTTCAATTGTTGTCTTTTCAAGTGCTGTTTTTGTTGTCTCCTTGATTTTGGTTCGTCTCCTTTATCTCTTATACTGTAGCAGCAAGCCCTTGAGCAAAAGGGCTTCAAAACCTTTTAGTACCCTTATTATTTTAGGATCAGGTCGTCATATTGTTGAGATGCTTAATCTACTGGCAGTGTTACAGAAAGGTAGGTTTAATCCAAGATTCTACATTGCTGCTGCTACTGATAATATGAGTCTTCAAAAAGCTCAGTTGTTGGAGAATTCCCTGGCTGCTGAGGTTCTATTTTTTGCTATGTCTCTCAAAGTACCTTTTATTCAATGA
Predicted protein sequences of Glyma17g19771
>Glyma17g19771.1   sequence type=predicted peptide   gene model=Glyma17g19771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAIPITSSYASTFSYSAGEDVIVALTDILKLPLMDKSNGCSFSSISSIVVFSSAVFVVSLILVRLLYLLYCSSKPLSKRASKPFSTLIILGSGRHIVEMLNLLAVLQKGRFNPRFYIAAATDNMSLQKAQLLENSLAAEVLFFAMSLKVPFIQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo