SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g17890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g17890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g17890

Feature Type:gene_model
Chromosome:Gm17
Start:14956495
stop:14958480
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G37470AT Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein | chr4:17617045-17618363 REVERSE LENGTH=270 SoyBaseE_val: 2.00E-152ISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009704GO-bp Annotation by Michelle Graham. GO Biological Process: de-etiolation SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
KOG4178 KOG Soluble epoxide hydrolase JGI ISS
PTHR10992Panther ALPHA/BETA HYDROLASE RELATED JGI ISS
PTHR10992:SF13Panther BIPHENYL HYDROLASE-RELATED JGI ISS
PF00561PFAM alpha/beta hydrolase fold JGI ISS
UniRef100_B9SG47UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sigma factor sigb regulation protein rsbq, putative n=1 Tax=Ricinus communis RepID=B9SG47_RICCO SoyBaseE_val: 1.00E-158ISS
UniRef100_I1MVQ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MVQ0_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g17890 not represented in the dataset

Glyma17g17890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g164400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g17890.1   sequence type=CDS   gene model=Glyma17g17890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTATCGTGGAAGAGGCTCACAACGTGAGAATAGTAGGGAAGGGGAATGAAATCGTGATTCTTGCTCATGGGTTCGGCACGGACCAATCGGTGTGGAAGCACCTTGTACCGCATCTGGTCGATGATTACCAAGTGATCTTGTACGACAACATGGGTGCTGGTACCACGAACCCAGACTACTTCGACTTCGAACGTTACTACACGATCGATGGTTTTGTCTATGACCTACTCGCCATCTTGCAAGAGCTTCAGGTGCAATCTTGTATCTTCGTTGGCCACTCTCTTTCTGCTATGGTGGGCCTCCTCGCTTCCATCTCTCACCCTCATCTCTTCACTAAACTCATCCTTGTCTCTGCCTCTCCAAGGTTTCTGAATGATTCAGAATACTTTGGAGGGTTCCAGCAAGAAGATCTGACCCAACTCTACGATGGAATCCGGTCGAATTACAAAGCATGGTGTTCGGGGTTCGCTCCGCTGGTGATCGGCGGCGACATGGACTCGGTGGCGGTGCAGGAGTTCAGCCGAACGCTCTTCAACATGCGGCCAGACATAGCCTTGAGTTTGGCGCAGACCATATTCCAGTTCGACATGAGGCCAATCCTATGCCACGTCACGGTGCCGTGCCACATCATTCAGAGCACCAAGGACCTGGCTGCGCCGGTTGTGGTGGCGGAGTATCTGCAGCAGAATTTGGGAGGGAAGACCATCGTGGAGGTCATGCCCACCGAGGGCCACTTGCCGCAGCTGAGCTCGCCGGATATTGTGGTTCCGGTTTTGCTCAACCACATCCGACACAATTTGGCAGAGGACAAATAA

>Glyma17g17890.1   sequence type=predicted peptide   gene model=Glyma17g17890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGIVEEAHNVRIVGKGNEIVILAHGFGTDQSVWKHLVPHLVDDYQVILYDNMGAGTTNPDYFDFERYYTIDGFVYDLLAILQELQVQSCIFVGHSLSAMVGLLASISHPHLFTKLILVSASPRFLNDSEYFGGFQQEDLTQLYDGIRSNYKAWCSGFAPLVIGGDMDSVAVQEFSRTLFNMRPDIALSLAQTIFQFDMRPILCHVTVPCHIIQSTKDLAAPVVVAEYLQQNLGGKTIVEVMPTEGHLPQLSSPDIVVPVLLNHIRHNLAEDK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo