|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G65870 | AT | Annotation by Michelle Graham. TAIR10: phytosulfokine 5 precursor | chr5:26351593-26352055 FORWARD LENGTH=77 | SoyBase | E_val: 4.00E-15 | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0009963 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0015824 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proline transport | SoyBase | N/A | ISS |
| GO:0030154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell differentiation | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0031012 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix | SoyBase | N/A | ISS |
| GO:0008083 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: growth factor activity | SoyBase | N/A | ISS |
| PF06404 | PFAM | Phytosulfokine precursor protein (PSK) | JGI | ISS | |
| UniRef100_B9SH34 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Phytosulfokines, putative n=1 Tax=Ricinus communis RepID=B9SH34_RICCO | SoyBase | E_val: 7.00E-22 | ISS |
| UniRef100_I1MVI9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MVI9_SOYBN | SoyBase | E_val: 3.00E-51 | ISS |
|
Glyma17g17120 not represented in the dataset |
Glyma17g17120 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.17g159000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma17g17120.1 sequence type=CDS gene model=Glyma17g17120 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACCAAGGTCACTGCCCTATTTTTCACCTTATTACTCTGCTCCATGCTCGTCCATGCCATGTCCATACGCCTTGAACCAGCTTTTCACCAAGAATCCTTAGCCAAACCGCACCAACAGAGCGTTGAGGCGGTTGATGAGAGCTGCGAAGGCGTTGGAGAGGATGAATGCTTGATGAGGAGAACACTTGCCGCTCACGTTGACTATATTTATACTCAAAAGCATAATAATCCTTGA
>Glyma17g17120.1 sequence type=predicted peptide gene model=Glyma17g17120 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTKVTALFFTLLLCSMLVHAMSIRLEPAFHQESLAKPHQQSVEAVDESCEGVGEDECLMRRTLAAHVDYIYTQKHNNP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||