Report for Sequence Feature Glyma17g17100
Feature Type: gene_model
Chromosome: Gm17
Start: 13926316
stop: 13926822
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g17100
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G49760 AT
Annotation by Michelle Graham. TAIR10: basic leucine-zipper 5 | chr3:18455569-18456039 REVERSE LENGTH=156
SoyBase E_val: 3.00E-27 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009410 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus
SoyBase N/A ISS
GO:0030968 GO-bp
Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
GO:0046983 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity
SoyBase N/A ISS
PTHR22952 Panther
CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED
JGI ISS
PTHR22952:SF60 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00170 PFAM
bZIP transcription factor
JGI ISS
UniRef100_G7JF85 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ocs element-binding factor n=1 Tax=Medicago truncatula RepID=G7JF85_MEDTR
SoyBase E_val: 3.00E-61 ISS
UniRef100_I1MVI7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MVI7_SOYBN
SoyBase E_val: 2.00E-118 ISS
Expression Patterns of Glyma17g17100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g17100
Paralog Evidence Comments
Glyma05g22860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g17100 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g158900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g17100
Coding sequences of Glyma17g17100
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g17100.1 sequence type=CDS gene model=Glyma17g17100 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTTTCTCTCCCTCCCTCCGACCCCTTCTCCACCTTCTCCGCCGGCTTCACGCCGTGGGACCACGATGAGGATTCCCACGCCCTCTTCTCCCCCAAACCCGTCTCTTCCAGCTCCGGCTCTGACGACAAATCCGAACCGAACCAACATGTATCCGCCTCCTCCACGGCGATGGAGGAGCGGAAACGGCGCCGCATGATATCGAACCGGGAATCGGCCCGCAGGTCCAGGATGCGGAAACAGAGACACCTGGAGAACCTTCGGAACCAGTTGAACAAGTGCAGGGTCGAAAACCGGGAACTGAGTAACCGGTTGCAGTTCGTCCTGCACCACTTGAACCGCCTCCGAACCGAAAACGAATGGTTACACTCCGAGCGAACCTTGCTCCGCCAAAAAGTCGCCAACTTAACACAAATTTTGATTTTCCAACAATTCCAAACTTTCTCCCCTGCATGGACATGCACCAACAACAACACCTCGCTCATGACAATTAATCAAGTTAATTAA
Predicted protein sequences of Glyma17g17100
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g17100.1 sequence type=predicted peptide gene model=Glyma17g17100 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLSLPPSDPFSTFSAGFTPWDHDEDSHALFSPKPVSSSSGSDDKSEPNQHVSASSTAMEERKRRRMISNRESARRSRMRKQRHLENLRNQLNKCRVENRELSNRLQFVLHHLNRLRTENEWLHSERTLLRQKVANLTQILIFQQFQTFSPAWTCTNNNTSLMTINQVN*