Glyma17g17100 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g17100

Feature Type:	gene_model
Chromosome:	Gm17
Start:	13926316
stop:	13926822
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g17100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G49760	AT	Annotation by Michelle Graham. TAIR10: basic leucine-zipper 5 \| chr3:18455569-18456039 REVERSE LENGTH=156	SoyBase	E_val: 3.00E-27	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009410	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
PTHR22952	Panther	CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED	JGI		ISS
PTHR22952:SF60	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00170	PFAM	bZIP transcription factor	JGI		ISS
UniRef100_G7JF85	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ocs element-binding factor n=1 Tax=Medicago truncatula RepID=G7JF85_MEDTR	SoyBase	E_val: 3.00E-61	ISS
UniRef100_I1MVI7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MVI7_SOYBN	SoyBase	E_val: 2.00E-118	ISS

Expression Patterns of Glyma17g17100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g17100

Paralog	Evidence	Comments
Glyma05g22860	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g17100 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g158900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g17100

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g17100

Limit To All Plant Sequences

>Glyma17g17100.1   sequence type=CDS   gene model=Glyma17g17100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTTCTCTCCCTCCCTCCGACCCCTTCTCCACCTTCTCCGCCGGCTTCACGCCGTGGGACCACGATGAGGATTCCCACGCCCTCTTCTCCCCCAAACCCGTCTCTTCCAGCTCCGGCTCTGACGACAAATCCGAACCGAACCAACATGTATCCGCCTCCTCCACGGCGATGGAGGAGCGGAAACGGCGCCGCATGATATCGAACCGGGAATCGGCCCGCAGGTCCAGGATGCGGAAACAGAGACACCTGGAGAACCTTCGGAACCAGTTGAACAAGTGCAGGGTCGAAAACCGGGAACTGAGTAACCGGTTGCAGTTCGTCCTGCACCACTTGAACCGCCTCCGAACCGAAAACGAATGGTTACACTCCGAGCGAACCTTGCTCCGCCAAAAAGTCGCCAACTTAACACAAATTTTGATTTTCCAACAATTCCAAACTTTCTCCCCTGCATGGACATGCACCAACAACAACACCTCGCTCATGACAATTAATCAAGTTAATTAA

Predicted protein sequences of Glyma17g17100

Limit To All Plant Sequences

>Glyma17g17100.1   sequence type=predicted peptide   gene model=Glyma17g17100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSLPPSDPFSTFSAGFTPWDHDEDSHALFSPKPVSSSSGSDDKSEPNQHVSASSTAMEERKRRRMISNRESARRSRMRKQRHLENLRNQLNKCRVENRELSNRLQFVLHHLNRLRTENEWLHSERTLLRQKVANLTQILIFQQFQTFSPAWTCTNNNTSLMTINQVN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain