Report for Sequence Feature Glyma17g16650
Feature Type: gene_model
Chromosome: Gm17
Start: 13384909
stop: 13385722
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g16650
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G35290 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 39 Blast hits to 39 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:14861635-14862000 REVERSE LENGTH=121
SoyBase E_val: 5.00E-29 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009741 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1MVF4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MVF4_SOYBN
SoyBase E_val: 7.00E-89 ISS
Expression Patterns of Glyma17g16650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g16650
Paralog Evidence Comments
Glyma05g23650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g16650 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g155300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g16650
Coding sequences of Glyma17g16650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g16650.1 sequence type=CDS gene model=Glyma17g16650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAATTGCTTGGTCATGCCATTATCATTGATCCGAAGACGCTCCATGGGGTACAGGCCCCTAACGAAGGACAAAGAATGTGACAGCCCTGTGACCGTGGTGGTCGGAAAAGAGAATAGGGTGTTCCTGGTGGACCCTTTCATATTACAAGAGAACCCTTTTCGGGTTTTGATGGACACGTCCATGAGGAAGCAGCTGGAGGAGGATCAAGAGGACAACAACAAGGATCATCATCATAATAATCTCCATCAACCTAGTAAGGTGGTCTTTGTCGATGTGGATGCCATTTTGTTCGAGCACATGTTGTGGCTCATGCACAATGATTGTTCTTCTTTGTTCGAGCTTAATTTGAAGGAGATTATTGACTTCTACGCTCAGGATATATGA
Predicted protein sequences of Glyma17g16650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g16650.1 sequence type=predicted peptide gene model=Glyma17g16650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNCLVMPLSLIRRRSMGYRPLTKDKECDSPVTVVVGKENRVFLVDPFILQENPFRVLMDTSMRKQLEEDQEDNNKDHHHNNLHQPSKVVFVDVDAILFEHMLWLMHNDCSSLFELNLKEIIDFYAQDI*