SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g16620

Feature Type:gene_model
Chromosome:Gm17
Start:13354202
stop:13355951
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g16620
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32560AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant protein, group 1 protein | chr1:11774528-11775032 FORWARD LENGTH=134 SoyBaseE_val: 2.00E-26ISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03760PFAM Late embryogenesis abundant (LEA) group 1 JGI ISS
UniRef100_Q9ZTZ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Late-embryogenesis abundant protein n=1 Tax=Glycine max RepID=Q9ZTZ2_SOYBN SoyBaseE_val: 1.00E-90ISS
UniRef100_Q9ZTZ2UniRef Annotation by Michelle Graham. Best UniRef hit: Late-embryogenesis abundant protein n=1 Tax=Glycine max RepID=Q9ZTZ2_SOYBN SoyBaseE_val: 1.00E-90ISS

Expression Patterns of Glyma17g16620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g16620
ParalogEvidenceComments
Glyma05g23680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g16620 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g155000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g16620
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g16620
>Glyma17g16620.1   sequence type=CDS   gene model=Glyma17g16620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAATCCTCAAAGGAGAAGATGAAAAACATGGCAAGTGCTGCCAAGGAACAAGTCGACATCTATAAAGCCAAAATAGACGAGAAGGCAGAGAAAGCAACGGCAAGAACAGAAGAGGAGAGGGTGATAGCCCATGAGCACGCAAAGGCAAAGGAAGCTGGAGCAAAGATGGAGCTGCATGAAGCTAAAGCAAGGCATGCAGCAGAGAAGCTAAGCGCCAACCAATCACATTATGGTCTCCACCATGGCCACAACAACCCTCCCTTAGTAGGAACAACTCAGACTCACTACCAGCAAGGGCACCAGCACCAGCCACTTGGGGCAGTTCCTATGCCTGGAACCACTTATCCATCTTATCCACTAGGAGGAAACCCTAACCCTCCAAGGAACAAACATATATAA
Predicted protein sequences of Glyma17g16620
>Glyma17g16620.1   sequence type=predicted peptide   gene model=Glyma17g16620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAGAKMELHEAKARHAAEKLSANQSHYGLHHGHNNPPLVGTTQTHYQQGHQHQPLGAVPMPGTTYPSYPLGGNPNPPRNKHI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo