SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g15930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g15930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g15930

Feature Type:gene_model
Chromosome:Gm17
Start:12641629
stop:12643813
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44680AT Annotation by Michelle Graham. TAIR10: casein kinase II beta subunit 4 | chr2:18426898-18428166 REVERSE LENGTH=282 SoyBaseE_val: 4.00E-135ISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0042753GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of circadian rhythm SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005956GO-cc Annotation by Michelle Graham. GO Cellular Compartment: protein kinase CK2 complex SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0019887GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase regulator activity SoyBaseN/AISS
KOG3092 KOG Casein kinase II, beta subunit JGI ISS
PTHR11740Panther CASEIN KINASE II BETA CHAIN JGI ISS
PF01214PFAM Casein kinase II regulatory subunit JGI ISS
UniRef100_I1MV89UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MV89_SOYBN SoyBaseE_val: 1.00E-152ISS
UniRef100_Q8LPD2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase Ck2 regulatory subunit 2 n=1 Tax=Nicotiana tabacum RepID=Q8LPD2_TOBAC SoyBaseE_val: 6.00E-135ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g15930 not represented in the dataset

Glyma17g15930 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g05620 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g149300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g15930.2   sequence type=CDS   gene model=Glyma17g15930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAATCTGAAACAGATGTCGAAGTGTCTGATGTTAGCGTTTCAGAAGGGGATGACACATCTTGGATTTCATGGTTTTGCAATTTGAGAGGAAATGAATTCTTTTGCGAAGTGGATGATGATTTCGTGCAAGATGATTTCAACCTTTGTGGATTAAGTAGTCAAGTGCCTTACTATGATTATGCACTTGATTTGATTTTGGATGTTGAGTCCTCCCACGGAGACACGTTCACAGAGGACCAAAATGAGTTAATTGAATCTGCAGCAGAAATGCTTTATGGTCTGATTCATGCCCGGTACATTTTGACAAGCAAAGGAATGGCTGCAATGCTTCACAAGTACAAAAACTATGACTTTGGCCGATGTCCAAGAGTTTTCTGCTCTGGACAACCCTGCCTTCCAGTTGGCCAGTCAGATGTTCCTAGGTCAAGTACTGTAAAGATATATTGCCCCAGGTGTGAAGACATTTACTACCCAAAGTCCAAGTATCAAGACATTGATGGAGCTTATTTTGGAGCTACATTTCCTCACCTTTTTCTGATGACTTATGGGAATCTGAAGCCACAGAAGCAATCACAGAACTATGTACCTAGAGTTTTTGGTTTCAAAGTTCACAAGTCCTGA

>Glyma17g15930.2   sequence type=predicted peptide   gene model=Glyma17g15930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ESETDVEVSDVSVSEGDDTSWISWFCNLRGNEFFCEVDDDFVQDDFNLCGLSSQVPYYDYALDLILDVESSHGDTFTEDQNELIESAAEMLYGLIHARYILTSKGMAAMLHKYKNYDFGRCPRVFCSGQPCLPVGQSDVPRSSTVKIYCPRCEDIYYPKSKYQDIDGAYFGATFPHLFLMTYGNLKPQKQSQNYVPRVFGFKVHKS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo