SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g15031): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g15031): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g15031

Feature Type:gene_model
Chromosome:Gm17
Start:11755375
stop:11759647
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16570AT Annotation by Michelle Graham. TAIR10: protein arginine methyltransferase 7 | chr4:9336815-9340692 FORWARD LENGTH=724 SoyBaseE_val: 3.00E-75ISS
GO:0006479GO-bp Annotation by Michelle Graham. GO Biological Process: protein methylation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
PTHR11006Panther PROTEIN ARGININE N-METHYLTRANSFERASE JGI ISS
PTHR11006:SF2Panther gb def: AT4g16570/dl4310w JGI ISS
UniRef100_G7JIX1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein arginine N-methyltransferase n=1 Tax=Medicago truncatula RepID=G7JIX1_MEDTR SoyBaseE_val: 3.00E-100ISS
UniRef100_UPI000233F0D2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F0D2 related cluster n=1 Tax=unknown RepID=UPI000233F0D2 SoyBaseE_val: 6.00E-117ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g15031 not represented in the dataset

Glyma17g15031 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g04600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g141300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g15031.1   sequence type=CDS   gene model=Glyma17g15031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATTTTTCAGTCACAGTTTGGACTTTCAATTGCAGCAGAATAGAAGCATAGTGCGGTTGTCTCCAACACACATTAATCTTCAAAAAATTGATATTAGTTATTATTGTTCAAATGAAAAGAGAGTTGATCTGTTGTTAGCAGAACCTTTCTATGTAGGGCATGATGGCATGCTTCCATGGCAGAACCTGCGGTTTTGGAAGGATCGTACAACACTTAGTGATATTCTCTCTGAAGATGCTCTGATAATTCCTTGTAAAGGAATATTGAGAGCATGTGCCGTCTCTCTTCCAGATCTTTGGAAAAGTCGTTGTTGCTTGAGTAATGTTGAAGGTTTTGACCATTCAGTGGTAAATGCTACATTGGGAGCCTGTGGTCATCTACCTGATTTAGAAGAGGGTCCTTGTCTGCCTTTTTTTGTCTGGCAATGTGGAGAATTTGATGTGCTTAGTGAGACATTTGATGTGATGGAGTTTGATTTTTCAAAACAAATATGCCAATGTCAAGGAAAATCCCAGGTTAAGTTCACCAAGACCGGGGTATGTCATGGATTTGTGCTGTGGATTAACTGGGTGATGGATTTGCAAAATTCTGTTGTGATATCAACTGGTCCAGGTCACTCATTTCCCTTTCCAACATTAACTAAAGCTATGAAGCCTCACTCTTCCATTCAACACCTGTGGCAAAAATTATAG

>Glyma17g15031.1   sequence type=predicted peptide   gene model=Glyma17g15031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFFSHSLDFQLQQNRSIVRLSPTHINLQKIDISYYCSNEKRVDLLLAEPFYVGHDGMLPWQNLRFWKDRTTLSDILSEDALIIPCKGILRACAVSLPDLWKSRCCLSNVEGFDHSVVNATLGACGHLPDLEEGPCLPFFVWQCGEFDVLSETFDVMEFDFSKQICQCQGKSQVKFTKTGVCHGFVLWINWVMDLQNSVVISTGPGHSFPFPTLTKAMKPHSSIQHLWQKL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo