Glyma17g14940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g14940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g14940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g14940

Feature Type:	gene_model
Chromosome:	Gm17
Start:	11694048
stop:	11696783
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g14940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G47570	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). \| chr5:19292869-19294666 REVERSE LENGTH=125	SoyBase	E_val: 2.00E-64	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1MUZ6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUZ6_SOYBN	SoyBase	E_val: 2.00E-85	ISS
UniRef100_Q9FGK0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial n=1 Tax=Arabidopsis thaliana RepID=NDUB8_ARATH	SoyBase	E_val: 1.00E-61	ISS

Expression Patterns of Glyma17g14940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g14940 not represented in the dataset	Glyma17g14940 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g14940

Paralog	Evidence	Comments
Glyma05g04510	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g14940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g140500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g14940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g14940

Limit To All Plant Sequences

>Glyma17g14940.1   sequence type=CDS   gene model=Glyma17g14940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGGGAGATTGACGAACGCAGCATCGAGGATCTTAGGCGGAAACGGCGTCGTTTACCGATCCGTTGCTTCCTCTCTTCGCCTCCGCTCCGGCATGGGCCTCCCCGTCGGCAAACACTATGTTCCCGACAAACCCCTTCCCATGAATGAGGAACTCCTGTGGGACAACGGCACTGCATTTCCCGAACCGTGTATAGATCGTATTGCTGACACTGTCGGAAAGTATGAAGCATTGGCCTGGCTGTGTGGGGGATTGAGTTTTTTCGCGTCGCTGGGATTGTTGGCTGTGTGGAATGACAAAGCCTCCAAGACACCGTTTGCACCCAAAGTATATCCATATGACAATCTGCGAGTGGAGCTTGGTGGTGAACCATAG

Predicted protein sequences of Glyma17g14940

Limit To All Plant Sequences

>Glyma17g14940.1   sequence type=predicted peptide   gene model=Glyma17g14940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGRLTNAASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTAFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKTPFAPKVYPYDNLRVELGGEP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain