SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g14910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g14910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g14910

Feature Type:gene_model
Chromosome:Gm17
Start:11673313
stop:11674153
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g14910
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45180AT Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr2:18626377-18626781 FORWARD LENGTH=134 SoyBaseE_val: 3.00E-46ISS
GO:0000038GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0042335GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle development SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_C6SVJ1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proline-rich protein n=1 Tax=Glycine max RepID=C6SVJ1_SOYBN SoyBaseE_val: 7.00E-65ISS
UniRef100_C6T126UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T126_SOYBN SoyBaseE_val: 2.00E-84ISS

Expression Patterns of Glyma17g14910
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g14910 not represented in the dataset
Glyma17g14910 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g14910 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g140200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g14910
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g14910
>Glyma17g14910.1   sequence type=CDS   gene model=Glyma17g14910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCAAGGGTGCACTTCTCTTGTGTCTCAACATTCTCTTCTTCACTGTGGTAAGCTCCACATATGTCCCATGCAACCCACCCCCTAAAACTCCTAAACACACACCTGTCCCAAAGCCACCTTCCCCAAAGCAACCAAGTTGCCCCAAAGACACCATTAAGTTTGGTGTGTGTGCTGATGTGTTAGGTTTGATTAACGTGCAACTTGGGAAGCCACCAAAGACCCCATGCTGCAACCTCATTCAGGGTCTTGCTGATCTTGAAGCTGCGGTGTGCCTTTGCACCGCTCTCAAAGCTAATGTGTTGGGCATCAACCTTAATGTCCCAGTCAAGTTGAGCTTGCTTCTCAACTACTGTGGAAAGGGTGTTCCCAAGGGATTCGTCTGCGCTTAA
Predicted protein sequences of Glyma17g14910
>Glyma17g14910.1   sequence type=predicted peptide   gene model=Glyma17g14910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKGALLLCLNILFFTVVSSTYVPCNPPPKTPKHTPVPKPPSPKQPSCPKDTIKFGVCADVLGLINVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVKLSLLLNYCGKGVPKGFVCA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo