SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g14786): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g14786): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g14786

Feature Type:gene_model
Chromosome:Gm17
Start:11548176
stop:11553859
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g14786
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G12440AT Annotation by Michelle Graham. TAIR10: adenine phosphoribosyl transferase 4 | chr4:7376268-7380120 FORWARD LENGTH=182 SoyBaseE_val: 4.00E-102ISS
GO:0006168GO-bp Annotation by Michelle Graham. GO Biological Process: adenine salvage SoyBaseN/AISS
GO:0009116GO-bp Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003999GO-mf Annotation by Michelle Graham. GO Molecular Function: adenine phosphoribosyltransferase activity SoyBaseN/AISS
KOG1712 KOG Adenine phosphoribosyl transferases JGI ISS
PTHR11776Panther PHOSPHORIBOSYLTRANSFERASE JGI ISS
PF00156PFAM Phosphoribosyl transferase domain JGI ISS
UniRef100_G7JW03UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenine phosphoribosyltransferase-like protein n=2 Tax=Medicago truncatula RepID=G7JW03_MEDTR SoyBaseE_val: 2.00E-112ISS
UniRef100_I1MUY2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUY2_SOYBN SoyBaseE_val: 2.00E-130ISS

Expression Patterns of Glyma17g14786
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g14786 not represented in the dataset
Glyma17g14786 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g14786
ParalogEvidenceComments
Glyma05g04310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g14786 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g138800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g14786
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g14786
>Glyma17g14786.1   sequence type=CDS   gene model=Glyma17g14786   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGACTTACAGAGACGAGGATCCCCGTCTTCATGACATCAAAACTAAGATTCGTGTTGTCCCTAATTTCCCCAAACCTGGTATTATGTTCCAAGACATTACTACTCTGTTGCTCGACCCCAAAGCCTTTAAAGACACGATAGATTTGTTCGTTGAGCGATACAAAGGCAAAAACATTTCTGTTGTTGCAGGAATTGAAGCTCGGGGTTTCATTTTTGGTTCTCCCATTGCTCTGGCAATAGGAGCAAAGTTTGTACCATTGAGGAAACCAAAAAAATTGCCTGGCAAAGTTATTTCTCAAGAGTATATTCTGGAATATGGAAGAGACTGTCTTGAGATGCATGTTGGAGCCGTTGAACCTGGTGAGCGTGCTTTAGTGGTTGATGATTTGATTGCCACTGGTGGAACTCTCTGTGCAGCCATGGACTTACTAGAGCGAGTGGGAGCAGAGGTAGTGGAGTGCGGATGTGTAATTGAATTGCCAGAATTAAAAGGCCGTGAACGGTTGAACGGGAAGGCCTTGTATGTGTTAGTGGAATGTTTTGAGTGCTGTCAGTAG
Predicted protein sequences of Glyma17g14786
>Glyma17g14786.1   sequence type=predicted peptide   gene model=Glyma17g14786   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTYRDEDPRLHDIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISVVAGIEARGFIFGSPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVEPGERALVVDDLIATGGTLCAAMDLLERVGAEVVECGCVIELPELKGRERLNGKALYVLVECFECCQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo