SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g14240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g14240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g14240

Feature Type:gene_model
Chromosome:Gm17
Start:11009003
stop:11013760
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G22890AT Annotation by Michelle Graham. TAIR10: PGR5-LIKE A | chr4:12007157-12009175 FORWARD LENGTH=324 SoyBaseE_val: 2.00E-168ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010304GO-bp Annotation by Michelle Graham. GO Biological Process: PSII associated light-harvesting complex II catabolic process SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7KET9UniRef Annotation by Michelle Graham. Most informative UniRef hit: PGR5-like protein 1A n=1 Tax=Medicago truncatula RepID=G7KET9_MEDTR SoyBaseE_val: 2.00E-167ISS
UniRef100_I1MUS7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUS7_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g14240 not represented in the dataset

Glyma17g14240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g03730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g133200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g14240.1   sequence type=CDS   gene model=Glyma17g14240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCACGGCTAGTAAGCTAGCCTTCACATTAACACCACCTCGTCCATGCACTGCACCTTTGACACCAATCTCTTCCTTGTCCTCTTCTTCTTCTTCTTCTTCTGCTTCAGCTTCTGGTATCAACTTCATTCAGTTCAATGGACGCCACTTATGCCTCCGACGCAGGCTGTTTCTACTCTCTCCTAAGGCCACTGCAGATCAACAAGGGAAGGTTGAAGAATTTGAAGATGATTCAAATGTTGTTGATAGTAAAATCCTCCCATATTGTAGCATAGATAAAAAAGAGAAGAAATCAATTGGTGAACTTGAACAGGAATTTCTTCAAGCACTGCAAGCATTCTATTATGAGGGAAAGGCTATCATGTCAAATGAAGAATTTGATAATCTCAAGGAAGAACTCATGTGGGAAGGAAGCAGCGTTGTCATGCTAAGTTCTGATGAGCAAAAATTCCTGGAAGCTTCTATGGCTTATGTGTCTGGAAATCCAATTATGAGTGACAAAGAGTTTGATGAGTTGAAACTGAGGCTAAAGAAAGAAGGGAGTGAAATTGTGGCTGAGGGTCCAAGGTGCAGTCTTCGTAGTAAAAAGGTTTACAGTGACCTATCTGTTGATTATTTGAAGATGTTCCTGCTGAACGTCCCGGCTACTGTGATTGCATTAGGATTGTTCTTCTTCCTCGATGATCTGACTGGATTTGAGATCACATATCTGCTAGAGCTGCCGGAGCCTTTTAGTTTCATTTTCACTTGGTTTGCTGCTGTTCCCCTCATTGTGTGGATAGCTCTGTCACTGACAAATGCCATTGTAAAAGACTTTGTGATTTTAAAGGGTCCTTGTCCGAACTGCGGTACTGAAAACACCTCTTTCTTTGGGACTATACTTTCAATTTCAAATGGTGGTTCCACCAACACTGTCAAATGCTCCAACTGTGGCACTGCAATGGAATATGATTCAACTTCAAGATTGATTACATTACCAGAAGGAAGTAACGCCTGA

>Glyma17g14240.1   sequence type=predicted peptide   gene model=Glyma17g14240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFTASKLAFTLTPPRPCTAPLTPISSLSSSSSSSSASASGINFIQFNGRHLCLRRRLFLLSPKATADQQGKVEEFEDDSNVVDSKILPYCSIDKKEKKSIGELEQEFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGNPIMSDKEFDELKLRLKKEGSEIVAEGPRCSLRSKKVYSDLSVDYLKMFLLNVPATVIALGLFFFLDDLTGFEITYLLELPEPFSFIFTWFAAVPLIVWIALSLTNAIVKDFVILKGPCPNCGTENTSFFGTILSISNGGSTNTVKCSNCGTAMEYDSTSRLITLPEGSNA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo