SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G09650 | AT | Annotation by Michelle Graham. TAIR10: ATP synthase delta-subunit gene | chr4:6100799-6101503 FORWARD LENGTH=234 | SoyBase | E_val: 1.00E-94 | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0006098 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt | SoyBase | N/A | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus | SoyBase | N/A | ISS |
| GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009772 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem II | SoyBase | N/A | ISS |
| GO:0009773 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I | SoyBase | N/A | ISS |
| GO:0009814 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
| GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0015986 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport | SoyBase | N/A | ISS |
| GO:0015995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process | SoyBase | N/A | ISS |
| GO:0019252 | GO-bp | Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0019760 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucosinolate metabolic process | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0043900 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
| GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
| GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0010287 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule | SoyBase | N/A | ISS |
| GO:0010319 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: stromule | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0046933 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism | SoyBase | N/A | ISS |
| KOG1662 | KOG | Mitochondrial F1F0-ATP synthase, subunit OSCP/ATP5 | JGI | ISS | |
| PTHR11910 | Panther | ATP SYNTHASE DELTA CHAIN | JGI | ISS | |
| PF00213 | PFAM | ATP synthase delta (OSCP) subunit | JGI | ISS | |
| UniRef100_G7JLC6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase n=1 Tax=Medicago truncatula RepID=G7JLC6_MEDTR | SoyBase | E_val: 5.00E-97 | ISS |
| UniRef100_I1MUQ0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUQ0_SOYBN | SoyBase | E_val: 0 | ISS |
|
Glyma17g13930 not represented in the dataset |
Glyma17g13930 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma05g03340 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.17g130100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma17g13930.1 sequence type=CDS gene model=Glyma17g13930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGTCTTTGCAGCACCCCACAGCTTCCCTCCAATCCAAACACATCCTAATCCCCCGAAATACCCTCTCCCAGAAACCCATCCTCAACCTCTCCCTCCATGGTACCACCTTCACCCCCCTCAAGCTCAAATTCGGCGTTACCACCACCACCACCGCCGCCGCCGCCACCCGCCGCTCCACCGGCGCCACGGGAGCCAGAATGTCAGCTACCGCAGCCTCCAGCTACGCCGCGGCCCTCGCCGACGTGGCGGCCGCGAACAACACCCTCGACGCGACAACCGCGGACATCGAGAAAATCGACGAAATCTTCTCGGACCCGCAGGTGTCGGACTACTTCGCGGACCCCACCCTGGCCGTGGAGAAGAAGCGCCAGCTGATAGACGAGATTGCGGAATCCTCGGAGTTCCAGCCCCACACGAGAAACTTCCTCTACATCCTCGTGGACGCGCAGAGGATAGACCTCATCAACGAGATAGCAAAAGAGTTCGAACTGGTTTACAATTCCTTGACCGAAACGGAGCTGGCGGTGGTGACGTCGGTGGTGAAGCTGGAGTCGCAGCACCTGGCGCAGATCGCGAAGCAGGTTCAGAAGCTCACTGGGACGAAGAACGTGAGAATTAAGACGCTCCTTGACCCTAGTTTGGTGGCGGGTTTCACTGTCAGGTATTCGGGCTCTAAGTTGATTGACATGAGCGTCAGGAAGCAGCTTGAGGATATTGCTGCTCAGCTTGAGCTGGGTGATATCTCACTCGCCGTATGA
>Glyma17g13930.1 sequence type=predicted peptide gene model=Glyma17g13930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASLQHPTASLQSKHILIPRNTLSQKPILNLSLHGTTFTPLKLKFGVTTTTTAAAATRRSTGATGARMSATAASSYAAALADVAAANNTLDATTADIEKIDEIFSDPQVSDYFADPTLAVEKKRQLIDEIAESSEFQPHTRNFLYILVDAQRIDLINEIAKEFELVYNSLTETELAVVTSVVKLESQHLAQIAKQVQKLTGTKNVRIKTLLDPSLVAGFTVRYSGSKLIDMSVRKQLEDIAAQLELGDISLAV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
