Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g13930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g13930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma17g13930
Feature Type: gene_model
Chromosome: Gm17
Start: 10704955
stop: 10706024
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g13930
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G09650 AT
Annotation by Michelle Graham. TAIR10: ATP synthase delta-subunit gene | chr4:6100799-6101503 FORWARD LENGTH=234
SoyBase E_val: 1.00E-94 ISS
GO:0000165 GO-bp
Annotation by Michelle Graham. GO Biological Process: MAPK cascade
SoyBase N/A ISS
GO:0006098 GO-bp
Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt
SoyBase N/A ISS
GO:0006364 GO-bp
Annotation by Michelle Graham. GO Biological Process: rRNA processing
SoyBase N/A ISS
GO:0006612 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane
SoyBase N/A ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0009595 GO-bp
Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus
SoyBase N/A ISS
GO:0009697 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process
SoyBase N/A ISS
GO:0009772 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem II
SoyBase N/A ISS
GO:0009773 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I
SoyBase N/A ISS
GO:0009814 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction
SoyBase N/A ISS
GO:0009862 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0010027 GO-bp
Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization
SoyBase N/A ISS
GO:0010200 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to chitin
SoyBase N/A ISS
GO:0010207 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosystem II assembly
SoyBase N/A ISS
GO:0010310 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process
SoyBase N/A ISS
GO:0010363 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response
SoyBase N/A ISS
GO:0015979 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis
SoyBase N/A ISS
GO:0015986 GO-bp
Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport
SoyBase N/A ISS
GO:0015995 GO-bp
Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process
SoyBase N/A ISS
GO:0019252 GO-bp
Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0019684 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction
SoyBase N/A ISS
GO:0019760 GO-bp
Annotation by Michelle Graham. GO Biological Process: glucosinolate metabolic process
SoyBase N/A ISS
GO:0031348 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0043900 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process
SoyBase N/A ISS
GO:0050832 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to fungus
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009534 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid
SoyBase N/A ISS
GO:0009535 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane
SoyBase N/A ISS
GO:0009579 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0010287 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule
SoyBase N/A ISS
GO:0010319 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: stromule
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0046933 GO-mf
Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism
SoyBase N/A ISS
KOG1662
KOG
Mitochondrial F1F0-ATP synthase, subunit OSCP/ATP5
JGI ISS
PTHR11910 Panther
ATP SYNTHASE DELTA CHAIN
JGI ISS
PF00213 PFAM
ATP synthase delta (OSCP) subunit
JGI ISS
UniRef100_G7JLC6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase n=1 Tax=Medicago truncatula RepID=G7JLC6_MEDTR
SoyBase E_val: 5.00E-97 ISS
UniRef100_I1MUQ0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUQ0_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma17g13930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g13930
Paralog Evidence Comments
Glyma05g03340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g13930 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g130100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g13930
Coding sequences of Glyma17g13930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g13930.1 sequence type=CDS gene model=Glyma17g13930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGTCTTTGCAGCACCCCACAGCTTCCCTCCAATCCAAACACATCCTAATCCCCCGAAATACCCTCTCCCAGAAACCCATCCTCAACCTCTCCCTCCATGGTACCACCTTCACCCCCCTCAAGCTCAAATTCGGCGTTACCACCACCACCACCGCCGCCGCCGCCACCCGCCGCTCCACCGGCGCCACGGGAGCCAGAATGTCAGCTACCGCAGCCTCCAGCTACGCCGCGGCCCTCGCCGACGTGGCGGCCGCGAACAACACCCTCGACGCGACAACCGCGGACATCGAGAAAATCGACGAAATCTTCTCGGACCCGCAGGTGTCGGACTACTTCGCGGACCCCACCCTGGCCGTGGAGAAGAAGCGCCAGCTGATAGACGAGATTGCGGAATCCTCGGAGTTCCAGCCCCACACGAGAAACTTCCTCTACATCCTCGTGGACGCGCAGAGGATAGACCTCATCAACGAGATAGCAAAAGAGTTCGAACTGGTTTACAATTCCTTGACCGAAACGGAGCTGGCGGTGGTGACGTCGGTGGTGAAGCTGGAGTCGCAGCACCTGGCGCAGATCGCGAAGCAGGTTCAGAAGCTCACTGGGACGAAGAACGTGAGAATTAAGACGCTCCTTGACCCTAGTTTGGTGGCGGGTTTCACTGTCAGGTATTCGGGCTCTAAGTTGATTGACATGAGCGTCAGGAAGCAGCTTGAGGATATTGCTGCTCAGCTTGAGCTGGGTGATATCTCACTCGCCGTATGA
Predicted protein sequences of Glyma17g13930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g13930.1 sequence type=predicted peptide gene model=Glyma17g13930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASLQHPTASLQSKHILIPRNTLSQKPILNLSLHGTTFTPLKLKFGVTTTTTAAAATRRSTGATGARMSATAASSYAAALADVAAANNTLDATTADIEKIDEIFSDPQVSDYFADPTLAVEKKRQLIDEIAESSEFQPHTRNFLYILVDAQRIDLINEIAKEFELVYNSLTETELAVVTSVVKLESQHLAQIAKQVQKLTGTKNVRIKTLLDPSLVAGFTVRYSGSKLIDMSVRKQLEDIAAQLELGDISLAV*