Glyma17g13820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g13820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g13820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g13820

Feature Type:	gene_model
Chromosome:	Gm17
Start:	10616633
stop:	10617551
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g13820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G76650	AT	Annotation by Michelle Graham. TAIR10: calmodulin-like 38 \| chr1:28766909-28767442 REVERSE LENGTH=177	SoyBase	E_val: 2.00E-33	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
KOG0027	KOG	Calmodulin and related proteins (EF-Hand superfamily)	JGI		ISS
PTHR10891	Panther	CALMODULIN	JGI		ISS
PTHR10891:SF141	Panther	CALCIUM-BINDING PROTEIN	JGI		ISS
PF00036	PFAM	EF hand	JGI		ISS
UniRef100_G7JLF5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Calcium-binding protein n=1 Tax=Medicago truncatula RepID=G7JLF5_MEDTR	SoyBase	E_val: 3.00E-67	ISS
UniRef100_I1MUN9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUN9_SOYBN	SoyBase	E_val: 1.00E-92	ISS

Expression Patterns of Glyma17g13820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g13820 not represented in the dataset	Glyma17g13820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g13820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g128900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g13820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g13820

Limit To All Plant Sequences

>Glyma17g13820.1   sequence type=CDS   gene model=Glyma17g13820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAGGGGTGCGGAATACGAGCGTGTGCTAAGGTACTTCGATGAAGACGGTGATGGAAAGATTTCACCCTCAGAGCTAAGGAACAGAATAGCAATGATGGGTGGTGAGGTTATGTTGAAGGAGGCTGAGATGGCGATCGAGGCGTTGGATTCGGACGGCGACGGGTTGTTGTGTTTGGACGATTTGATGAATCTGATGGAGGCTGCTGGAGAAGAAGAGAAGTTGAAGGATTTGAGAGAAGCCTTTGATATGTATGATACGGAGAGGTGTGGGTTTATTACTCCAAAGGCCTTGAAGAGGATGCTGAAGAAGTTAGGGGAATCTAAGTCAATGGTAGAGTGCAAAGTGATGATAAGTAGGTTTGATTTGAATGGGGATGGCATGCTTAGCTTTGAAGAGTTCAGAATTATGATGAAGTGA

Predicted protein sequences of Glyma17g13820

Limit To All Plant Sequences

>Glyma17g13820.1   sequence type=predicted peptide   gene model=Glyma17g13820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMRGAEYERVLRYFDEDGDGKISPSELRNRIAMMGGEVMLKEAEMAIEALDSDGDGLLCLDDLMNLMEAAGEEEKLKDLREAFDMYDTERCGFITPKALKRMLKKLGESKSMVECKVMISRFDLNGDGMLSFEEFRIMMK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain