Report for Sequence Feature Glyma17g13590
Feature Type: gene_model
Chromosome: Gm17
Start: 10415116
stop: 10417140
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g13590
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G63270 AT
Annotation by Michelle Graham. TAIR10: RPM1-interacting protein 4 (RIN4) family protein | chr5:25365498-25365949 REVERSE LENGTH=80
SoyBase E_val: 7.00E-21 ISS
GO:0010167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to nitrate
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF05627 PFAM
Cleavage site for pathogenic type III effector avirulence factor Avr
JGI ISS
UniRef100_G7JMP0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: NOI protein n=1 Tax=Medicago truncatula RepID=G7JMP0_MEDTR
SoyBase E_val: 7.00E-28 ISS
UniRef100_I1K074 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K074_SOYBN
SoyBase E_val: 1.00E-42 ISS
Expression Patterns of Glyma17g13590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g13590
Paralog Evidence Comments
Glyma05g02930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g13590 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g126900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g13590
Coding sequences of Glyma17g13590
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g13590.2 sequence type=CDS gene model=Glyma17g13590 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTTCGCAGGAGAATGGTCGTCCATTGCCTAAATTCGGTGAGTGGGATGTGAATAATCCTGCCTCAGCGGAAGGTTTTACTGTCATATTCAACAAGGCTAGAGATGAGAAGAAGACTAACACAGCAACGGCAACCCCAACCCCACGTAGATCTGATCCTGTGTTCAAGAATGAGAATTATAACAATCCTCAATATTCTGGAAAGAGAAAGTGGTTTTGCTGCGGCTGA
Predicted protein sequences of Glyma17g13590
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g13590.2 sequence type=predicted peptide gene model=Glyma17g13590 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSSQENGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTNTATATPTPRRSDPVFKNENYNNPQYSGKRKWFCCG*