SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g13380

Feature Type:gene_model
Chromosome:Gm17
Start:10229744
stop:10231783
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G12690AT Annotation by Michelle Graham. TAIR10: Plant protein of unknown function (DUF868) | chr4:7480896-7481753 FORWARD LENGTH=285 SoyBaseE_val: 1.00E-66ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05910PFAM Plant protein of unknown function (DUF868) JGI ISS
UniRef100_B9SVM2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein phosphatase 2c, putative n=1 Tax=Ricinus communis RepID=B9SVM2_RICCO SoyBaseE_val: 2.00E-113ISS
UniRef100_UPI000233E501UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E501 related cluster n=1 Tax=unknown RepID=UPI000233E501 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g02680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g124600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g13380.1   sequence type=CDS   gene model=Glyma17g13380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCAAGACTCAATTGGGATCCCTGCTTGCTTTTCTTCTTCAGCAGAGAAGCAGCATAGCCACCACGATCATGATCATGGAGCTGTGACCCGTTCTGGTCAGAGCGTGTACATGTCTGTGTATAGAACAAAGGTTGCTGATCACTGCCGTTTGATCACCATTACATGGTGCAAAAACCTCTTGCTTCATGGGCTTTCGGTGTCAGTGGAAGGCCCAGAAGGAGAAGAACAGTACTACACCTGCAAGGTCGAGCTGAAGCCATGGTACTTTTGGAGGAAACAAGGTTCCAAGCGCTTCATAGTAGATGGCAAAGCCGTTGACATTTTCTGGGACCTTAAAGCTGCAAAATTTAACGGAGAAACAGAACCAACCTCGGAGTACTATGTGGCAGTGGTTTGTGATGAAGAGGTTGTTCTTCTTCTCGGTGATCTAAAGAAAGAGGCATACCGAAGGACGGGGTGTAGGCCAGCACTCATTGACCCCATTTTGGTTTCAAAGAAAGAACACATTTTTGGCAAGAAGAAGTTCTCCACTAGAGCCAAGTTTCACGAGAAGGGTAGGTGGCATGAGATTTCGATTGAGTGCAAGAACAAGGGAAATAATAATTATAATGTGGATTCTTTAAATGGGGTTCAGCCAGAGATGGAGATAAGGATTGATGGGCACTTGGTGATTCATGTGAAGCACTTGCAATGGAAGTTTAGAGGCAACGAATCAATTCATCTCAGCAAAATGAGAGTAGAGATTGAGATTGGGTTTGGATTGAGAAAGCAAGTGGGGCCAAACAGTGGCTTTGGGAGTTAG

>Glyma17g13380.1   sequence type=predicted peptide   gene model=Glyma17g13380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMQDSIGIPACFSSSAEKQHSHHDHDHGAVTRSGQSVYMSVYRTKVADHCRLITITWCKNLLLHGLSVSVEGPEGEEQYYTCKVELKPWYFWRKQGSKRFIVDGKAVDIFWDLKAAKFNGETEPTSEYYVAVVCDEEVVLLLGDLKKEAYRRTGCRPALIDPILVSKKEHIFGKKKFSTRAKFHEKGRWHEISIECKNKGNNNYNVDSLNGVQPEMEIRIDGHLVIHVKHLQWKFRGNESIHLSKMRVEIEIGFGLRKQVGPNSGFGS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo