Report for Sequence Feature Glyma17g13250
Feature Type: gene_model
Chromosome: Gm17
Start: 10130699
stop: 10132663
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g13250
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G23100 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF617 | chr5:7753557-7754390 FORWARD LENGTH=277
SoyBase E_val: 1.00E-93 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF04759 PFAM
Protein of unknown function, DUF617
JGI ISS
UniRef100_B6U2A5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Plant-specific domain TIGR01570 family protein n=1 Tax=Zea mays RepID=B6U2A5_MAIZE
SoyBase E_val: 2.00E-76 ISS
UniRef100_I1MUI0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUI0_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma17g13250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g13250
Paralog Evidence Comments
Glyma05g07760 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g13250 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g123500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g13250
Coding sequences of Glyma17g13250
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g13250.1 sequence type=CDS gene model=Glyma17g13250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGACACTAGTCATGGACACAACAAACTCATCAACCCCTCGACCTCAACCTCAACCTCAAGACTCATCCTCCTCCAAGAGGCACTTCCACTGGACCAACAAGGTTGGAAATGAAGACCCCCAACTCCTCCCCACTTCAGAAACAATGTCCAAAATCATAGAAGAAGACACAAACACAAAGGAAGAAGAAGAACAACAAGAACCAGAAGATGACAAGGCTGTTCCACTTCCTGGCCCTGCAGCCACTTCTCAAGCAGCAGCAACAAAGAGAAAGCTTCAAGCAGTGGCAATCTCAAGGCTCCGCTCTGTTCTCACTGTATTCAGCAAGAACCGTTCCAACCTCCCCTTCGGCCTCGGCTCCAGAGTTGTTGGCACCCTCTTCGGCTACCGCCGTGGCCACGTGCACTTCGCCTTCCAGAAGGACCCCACCTCCCAGCCCGCCTTCCTTATTGAGCTCGCGACGCCAATCAGCGGACTAGTCCGTGAAATGGCGTCGGGGCTGGTGCGAATTGCTTTGGAGTGTGACAAAGACAGAGACTCAGAGAAGAAGAAGACCCTGAGGCTGCTTCAGGAGTCCGTCTGGAGGACTTACTGCAACGGTAAAAAATGCGGCTTTGCCACCAGGAGAGAATGCGGTGCCAAAGACTGGGACATACTTAAGGCAGTGGAGCCAATTTCAATGGGTGCAGGTGTTTTGCCTAACAGTGATGGAGCCGATGGTGAAGTCATGTACATGAGGGCAAGGTTTGAGAGAATTGTTGGGTCCAGAGACTCTGAAGCTTTCTACATGATGAATCCTGACAGCAATGGAGCACCTGAACTCAGTATTTATTTGCTTAGAGTCTAG
Predicted protein sequences of Glyma17g13250
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g13250.1 sequence type=predicted peptide gene model=Glyma17g13250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKTLVMDTTNSSTPRPQPQPQDSSSSKRHFHWTNKVGNEDPQLLPTSETMSKIIEEDTNTKEEEEQQEPEDDKAVPLPGPAATSQAAATKRKLQAVAISRLRSVLTVFSKNRSNLPFGLGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFLIELATPISGLVREMASGLVRIALECDKDRDSEKKKTLRLLQESVWRTYCNGKKCGFATRRECGAKDWDILKAVEPISMGAGVLPNSDGADGEVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV*