SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g12840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g12840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g12840

Feature Type:gene_model
Chromosome:Gm17
Start:9702861
stop:9704315
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G19980AT Annotation by Michelle Graham. TAIR10: golgi nucleotide sugar transporter 4 | chr5:6749907-6750932 REVERSE LENGTH=341 SoyBaseE_val: 5.00E-166ISS
GO:0015780GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide-sugar transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
KOG1444 KOG Nucleotide-sugar transporter VRG4/SQV-7 JGI ISS
PTHR11132Panther SOLUTE CARRIER FAMILY 35 JGI ISS
UniRef100_G7JU76UniRef Annotation by Michelle Graham. Most informative UniRef hit: GDP-mannose transporter n=1 Tax=Medicago truncatula RepID=G7JU76_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1MUE0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUE0_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g12840 not represented in the dataset

Glyma17g12840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g119300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g12840.1   sequence type=CDS   gene model=Glyma17g12840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAATGACGTGGGCGCGATTCGATTCGTGGAAGCAGCAATACTACACCACAAGCGGCGTGGTGGTAGGTTACGCAGTATGCTCCAGCCTCCTGGCCATCATCAACAAATACGCCATCACCAAATTCAACTACCCAGGCCTCTTAACCGCGCTCCAGTACCTCACCTCCGCACTCGGCGTCTACGTCTTTGGGAAATTAGGGTTTCTCCACCACGACCCCTTCACCCTCCCCACCGCCAAAAAATTCTTCCCCGCCGCCCTCGTCTTCTACCTCGCCATCTTCACCAACACCAATCTTCTCCGCCATGCCAACGTCGACACCTTCATCGTCTTCCGATCCCTCACCCCTCTCCTCGTCGCCCTCGCCGACACCGTCTTCCGCAGCCAGCCCTGCCCCTCCAACCTCACCTTCCTCTCCCTCCTCGTCATCCTCGCCGGCGCCTTCGGCTACGTCGCCACCGACTCCGCCTTCACCCTCACCGCCTACTCCTGGGCCTTCGCCTACCTCATCACCATCACCACCGAGATGGTCTACATCAAGCACATGGTCATGAGCCTCGGCCTCAACACATGGGGCTTCGTCTTCTACAACAACCTCCTCTCTCTTATGATGGCTCCCTTTTTCTCCTTCGTCACCGGCGAGAACGTCGAGATTATCGCCGCGGTTAGATCCGGCGGCCTTTTCGACCCCGCCGCCTTCTACGCCGTCTCCCTGTCTTGCCTCTTCGGCTTGCTCATTAGTTTCTTCGGGTTCGCGGCCAGGAGGGCCGTTTCCGCCACCGCGTTCACCGTCACCGGCGTGGTGAACAAGTTTCTCACTGTGGCGATCAATGTACTTATTTGGGATAAGCATGCTAGCCCCATTGGTTTGGTTTGCTTGTTTTTTACCATTGTTGGTGGGATTCTTTACCAGCAGTCTGTGACTGGGCTTGGGAGTGCTCCGGCCCAGCCCAAACAGTTGGATACTGAAAGCAACAAAGGTGGTGGCGAAGATGATGACGATGGTGATTTGACAGGTGAGAGTGATGGCTTGATTAAAGCTACTTCTATATAA

>Glyma17g12840.1   sequence type=predicted peptide   gene model=Glyma17g12840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTMTWARFDSWKQQYYTTSGVVVGYAVCSSLLAIINKYAITKFNYPGLLTALQYLTSALGVYVFGKLGFLHHDPFTLPTAKKFFPAALVFYLAIFTNTNLLRHANVDTFIVFRSLTPLLVALADTVFRSQPCPSNLTFLSLLVILAGAFGYVATDSAFTLTAYSWAFAYLITITTEMVYIKHMVMSLGLNTWGFVFYNNLLSLMMAPFFSFVTGENVEIIAAVRSGGLFDPAAFYAVSLSCLFGLLISFFGFAARRAVSATAFTVTGVVNKFLTVAINVLIWDKHASPIGLVCLFFTIVGGILYQQSVTGLGSAPAQPKQLDTESNKGGGEDDDDGDLTGESDGLIKATSI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo