SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g12796

Feature Type:gene_model
Chromosome:Gm17
Start:9686952
stop:9687934
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g12796
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G13770AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Putative harbinger transposase-derived nuclease (InterPro:IPR006912); Has 451 Blast hits to 352 proteins in 33 species: Archae - 0; Bacteria - 0; Metazoa - 28; Fungi - 8; Plants - 388; Viruses - 0; Other Eukaryotes - 27 (source: NCBI BLink). | chr2:5736603-5737847 FORWARD LENGTH=343 SoyBaseE_val: 7.00E-33ISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
PF04827PFAM Plant transposon protein JGI ISS
UniRef100_Q67V33UniRef Annotation by Michelle Graham. Best UniRef hit: Ribosomal protein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q67V33_ORYSJ SoyBaseE_val: 8.00E-33ISS
UniRef100_Q67V33UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q67V33_ORYSJ SoyBaseE_val: 8.00E-33ISS

Expression Patterns of Glyma17g12796
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g12796 not represented in the dataset
Glyma17g12796 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g12796 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g118900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g12796
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g12796
>Glyma17g12796.1   sequence type=CDS   gene model=Glyma17g12796   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCAAACATCAATTTTGATACGCTTTTGGATCAAATCATAGATGAAGAACTTGAAGACAACACCGATGAAGAAGTCATAAGGTATCTGTTTCTTCGATTTGTGGAGGCCTTCACCAATCATGATGAGTATTTCCAAATGAGGGTAGATGCAAAGCGTAGAAACGACTTATCACCGTTGCAGAAGTGCATTGGTGTTCTTCGTATATTAGCTTATGGCTTACCCGTTGACAGTGTGAATGAGTATATTCAGATTGCTGAAATTACTGTTGTGGAGTGCTTACAGAGATTTGTATCAGACATCTGTGCAATATTTGGGGATGAATACCTAAGGAGGCCAAATGACGAAGACACTAGAAGACTACTACAAATGGGAGCAATATGTGGCTTTTCAGCGGATGACATTTACCTAGAATTTGCTACATTTGTGAATACCATCTCAATGCCAAAAGGAGAAAAGAGAAAATTATTTGTAGAACGACAAGAATCAATAAGAAAGGATGTAGAGTGCTCCAATCTCGATTCATAA
Predicted protein sequences of Glyma17g12796
>Glyma17g12796.1   sequence type=predicted peptide   gene model=Glyma17g12796   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSNINFDTLLDQIIDEELEDNTDEEVIRYLFLRFVEAFTNHDEYFQMRVDAKRRNDLSPLQKCIGVLRILAYGLPVDSVNEYIQIAEITVVECLQRFVSDICAIFGDEYLRRPNDEDTRRLLQMGAICGFSADDIYLEFATFVNTISMPKGEKRKLFVERQESIRKDVECSNLDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo