SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g12530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g12530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g12530

Feature Type:gene_model
Chromosome:Gm17
Start:9458804
stop:9464917
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20080AT Annotation by Michelle Graham. TAIR10: FAD/NAD(P)-binding oxidoreductase | chr5:6782708-6786360 FORWARD LENGTH=328 SoyBaseE_val: 4.00E-172ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005758GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0004128GO-mf Annotation by Michelle Graham. GO Molecular Function: cytochrome-b5 reductase activity, acting on NAD(P)H SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0534 KOG NADH-cytochrome b-5 reductase JGI ISS
PTHR19370Panther NADH-CYTOCHROME B5 REDUCTASE JGI ISS
PTHR19370:SF11Panther SUBFAMILY NOT NAMED JGI ISS
PF00175PFAM Oxidoreductase NAD-binding domain JGI ISS
PF00970PFAM Oxidoreductase FAD-binding domain JGI ISS
UniRef100_C6TKA3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TKA3_SOYBN SoyBaseE_val: 0ISS
UniRef100_G7JVC5UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH-cytochrome b5 reductase-like protein n=1 Tax=Medicago truncatula RepID=G7JVC5_MEDTR SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g12530 not represented in the dataset

Glyma17g12530 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g08480 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g116400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g12530.1   sequence type=CDS   gene model=Glyma17g12530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCTCTCTTGAGGAGGTTTGCGAGCGCCACTCCGATCCCATCCAATTCCTCTCACACCAATCTCCGCCTTCCCTTCACCGCCATCGCCGCCATTTCCGGCGGAGTCTCCTTCCTTTTCTACCATTCCTCTCCCAACTTCGCTCATTCACAAGAAGCAGAACAAGTGGAAAGTAAAAACATCGCACTCGTTCCGGATAAATGGGTCGAGTTTAAGTTGCAGGATACTGCTAGGGTTAGTCACAATACCCAGCTATTCAGGTTTTCATTTGATCCCACTCAGAAATTGGGTCTGGATATTGCTTCTTGCATCCTTACAAGGGCTCCATTGGGACAAGATGCTGAAGGAAAACCAAAATTTGTCATACGCCCGTACACTCCTATTTCAGATCCAGAATCAAATGGCTATTTTGATTTGCTAATCAAGGTATATCCTGAAGGGAAAATGAGCCAGCATTTTGCAAGCTTAAAACCGGGTGATGTTGTTGAAGTGAAAGGGCCCATTGAAAAGCTCAGATATACTCCTAATATGAAGAAGCATATTGGCATGATTGCTGGAGGCACAGGAATTACTCCTATGCTTCAGGTAATTGAAGCTATATTGAGGAATCCTGATGACAAAACTCAGATATCTTTACTTTATGCTAATGTCTCCCCGGATGACATACTGCTTAAACAAAAGCTTGACATTCTTGCAACAAGCCACCCAAACTTAAAGATATTCTACACTGTAGATAATCCAACGAAAAATTGGAGAGGAGGTGCAGGTTACATATCAAAGGATGTGGTTGTGAAAGGCTTACCCAGTCCTAGTGATGATACTCTAATACTTGTGTGTGGACCCCCGGGTATGATGAAAGCAATATCTGGAGAAAAGGCCAAGGACTGGACACAAGGAGAGGTTTCTGGCATCCTAAAAGAGGCTGGATACACTGAACAAATGGTATACAAATTCTGA

>Glyma17g12530.1   sequence type=predicted peptide   gene model=Glyma17g12530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAALLRRFASATPIPSNSSHTNLRLPFTAIAAISGGVSFLFYHSSPNFAHSQEAEQVESKNIALVPDKWVEFKLQDTARVSHNTQLFRFSFDPTQKLGLDIASCILTRAPLGQDAEGKPKFVIRPYTPISDPESNGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLRYTPNMKKHIGMIAGGTGITPMLQVIEAILRNPDDKTQISLLYANVSPDDILLKQKLDILATSHPNLKIFYTVDNPTKNWRGGAGYISKDVVVKGLPSPSDDTLILVCGPPGMMKAISGEKAKDWTQGEVSGILKEAGYTEQMVYKF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo