Report for Sequence Feature Glyma17g12430
Feature Type: gene_model
Chromosome: Gm17
Start: 9407766
stop: 9409458
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g12430
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G20160 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein | chr5:6804075-6805102 REVERSE LENGTH=128
SoyBase E_val: 8.00E-76 ISS
GO:0000478 GO-bp
Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage involved in rRNA processing
SoyBase N/A ISS
GO:0001510 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA methylation
SoyBase N/A ISS
GO:0042254 GO-bp
Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005730 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleolus
SoyBase N/A ISS
GO:0003723 GO-mf
Annotation by Michelle Graham. GO Molecular Function: RNA binding
SoyBase N/A ISS
KOG3387
KOG
60S ribosomal protein 15.5kD/SNU13, NHP2/L7A family (includes ribonuclease P subunit p38), involved in splicing
JGI ISS
PTHR23105 Panther
60S RIBOSOMAL PROTEIN L10A - RELATED
JGI ISS
PTHR23105:SF11 Panther
RIBOSOMAL PROTEIN L7AE
JGI ISS
PF01248 PFAM
Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
JGI ISS
UniRef100_B9SEQ9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein l7ae, putative n=1 Tax=Ricinus communis RepID=B9SEQ9_RICCO
SoyBase E_val: 5.00E-86 ISS
UniRef100_I1MU97 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MU97_SOYBN
SoyBase E_val: 7.00E-87 ISS
Expression Patterns of Glyma17g12430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g12430
Paralog Evidence Comments
Glyma13g23690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g12430 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g115400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g12430
Coding sequences of Glyma17g12430
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g12430.1 sequence type=CDS gene model=Glyma17g12430 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACAGGAGAAGCAGTGAACCCCAAAGCTTACCCTTTGGCGGATGCCCAACTCTCAATAACCATACTAGACCTTGTTCAACAAGCTGCCAACTACAAGCAGCTCAAAAAAGGTGCTAATGAAGCCACTAAAACCCTGAACAGGGGTATCTCTGAATTTGTTGTGATGGCTGCTGATACTGAGCCCCTTGAGATTCTTCTACATCTTCCTCTACTTGCTGAGGATAAGAATGTGCCCTACGTGTTTGTCCCTTCAAAACAAGCACTTGGACGTGCATGTGGGGTCACCAGGCCAGTGATTGCTTGTTCTGTGACAACTAATGAAGGGAGTCAATTGAAATCTCAAATTCAGCAACTAAAGGATGCTATTGAGAAGCTTTTAATCTGA
Predicted protein sequences of Glyma17g12430
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g12430.1 sequence type=predicted peptide gene model=Glyma17g12430 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTGEAVNPKAYPLADAQLSITILDLVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTTNEGSQLKSQIQQLKDAIEKLLI*