SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g12390

Feature Type:gene_model
Chromosome:Gm17
Start:9366175
stop:9369114
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g12390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26680AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Methyltransferase FkbM (InterPro:IPR006342); Has 1073 Blast hits to 1073 proteins in 243 species: Archae - 45; Bacteria - 509; Metazoa - 0; Fungi - 4; Plants - 60; Viruses - 4; Other Eukaryotes - 451 (source: NCBI BLink). | chr2:11344003-11345288 REVERSE LENGTH=319 SoyBaseE_val: 2.00E-99ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1MU94UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MU94_SOYBN SoyBaseE_val: 1.00E-127ISS
UniRef100_O48783UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=O48783_ARATH SoyBaseE_val: 1.00E-96ISS

Expression Patterns of Glyma17g12390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g12390
ParalogEvidenceComments
Glyma13g23650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g12390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g115000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g12390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g12390
>Glyma17g12390.1   sequence type=CDS   gene model=Glyma17g12390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCCTTCGCCGCCTCCGCTATGGGGTTTCGGGTTCTGGCTTTCGAGCCTGTGTTCGAGAATTTGCAGAGGATCTGTGAAGGGGTTTACTTCAATAGAGTTGCGGATTTGGTCACTGTCTTCGAGGCCGCTGCGTCGGATCGCGTTGGCAACATCACCGTTCACAAGTTGGTTGGTAGGCTGGACAACAGTGCAATTTCTGCCACAGGTGCAAAGTTGGCATTTAAGTCGAATGAAGAGATAGCTTTTAAAGTACGGACCGTTCCTCTTGATGAAGTGATTCCAAAATCTGAGCGTGTGCTTCTGCTTAAAATAGATGTTCAGGGCTGGGAATATCACGTTCTTAAAGGAGCATCAAAGTTGCTCTCAAGGAAAGGAAGCCAAGCCCCATATCTCATATACGAAGAAGATGAGTGCTTATTACAGGCCAGTAATAGCAGTGCAAAAGAGATTCGAGACTTCCTCCATAGTGTGGGTTATCATGATTGCACCCAACATGGCACAGATGCACACTGCATCAAGAAGGATTGA
Predicted protein sequences of Glyma17g12390
>Glyma17g12390.1   sequence type=predicted peptide   gene model=Glyma17g12390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASFAASAMGFRVLAFEPVFENLQRICEGVYFNRVADLVTVFEAAASDRVGNITVHKLVGRLDNSAISATGAKLAFKSNEEIAFKVRTVPLDEVIPKSERVLLLKIDVQGWEYHVLKGASKLLSRKGSQAPYLIYEEDECLLQASNSSAKEIRDFLHSVGYHDCTQHGTDAHCIKKD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo