Glyma17g12330 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g12330

Feature Type:	gene_model
Chromosome:	Gm17
Start:	9333027
stop:	9334517
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g12330

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G15360	AT	Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein \| chr1:5283609-5284506 FORWARD LENGTH=199	SoyBase	E_val: 2.00E-72	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010143	GO-bp	Annotation by Michelle Graham. GO Biological Process: cutin biosynthetic process	SoyBase	N/A	ISS
GO:0010166	GO-bp	Annotation by Michelle Graham. GO Biological Process: wax metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_G7JD02	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor WIN1 n=1 Tax=Medicago truncatula RepID=G7JD02_MEDTR	SoyBase	E_val: 6.00E-110	ISS
UniRef100_I1MU89	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MU89_SOYBN	SoyBase	E_val: 1.00E-176	ISS

Expression Patterns of Glyma17g12330

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g12330

Paralog	Evidence	Comments
Glyma13g23570	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g12330 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g114500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g12330

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g12330

Limit To All Plant Sequences

>Glyma17g12330.1   sequence type=CDS   gene model=Glyma17g12330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCAATCAAAGAAGTTCAGAGGTGTCAGGCAACGCCATTGGGGTTCATGGGTATCCGAAATTCGCCACCCGCTTCTGAAGAGAAGGGTGTGGCTAGGGACATTTGAAACAGCAGAAGAAGCTGCTAGAGCCTATGATCAAGCTGCGATTCTGATGAGTGGGAGAAATGCCAAGACCAATTTCCCAATAACTCAAACTCCAGAAGGTGATCCAAAGAGCACTACCAGTGAGGACACTCCCTCCACCACCTCGAAGGATCTGGAGGAAATCTTACATGCAAAGCTTCGAAAATGTGGGAAGGTACCTTCACCTTCTATGACTTGTTTGAGGCTTGACCCGGAGAACTCCCACATCGGAGTGTGGCAAAAACGTGCTGGGAGGCGTTCTGATTCAAATTGGGTCATGACGGTTCAACTGGGAAAGAAGAGTGTTAATGTTAATAATAATGACACTCATCATCAAGCTGATAGTAGCAGTAGTAGTTCTCTTTCTTCTTCTCTACCTTCTTCTGAACATCACCACATTGAGTCTCCATCACTGGCTGTGACAGGTAATCTTCATCATCAAGAAGTTGTGAGAGGAGAGATTGACGAAGAGGAGAGAATTGCCCTTCAGATGATTGAGGAACTCCTCAACGACAGAAACTGCCCTAGCCCATCATTTAACAACAACATTCAAGAAAGGGATGGTGCTGATCATGACCACTTTTTTCTTTAA

Predicted protein sequences of Glyma17g12330

Limit To All Plant Sequences

>Glyma17g12330.1   sequence type=predicted peptide   gene model=Glyma17g12330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQSKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAARAYDQAAILMSGRNAKTNFPITQTPEGDPKSTTSEDTPSTTSKDLEEILHAKLRKCGKVPSPSMTCLRLDPENSHIGVWQKRAGRRSDSNWVMTVQLGKKSVNVNNNDTHHQADSSSSSSLSSSLPSSEHHHIESPSLAVTGNLHHQEVVRGEIDEEERIALQMIEELLNDRNCPSPSFNNNIQERDGADHDHFFL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain