SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g12260

Feature Type:gene_model
Chromosome:Gm17
Start:9278525
stop:9279535
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80133AT Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: endomembrane system; Has 154 Blast hits to 154 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 154; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:30143868-30144255 REVERSE LENGTH=99 SoyBaseE_val: 9.00E-10ISS
UniRef100_G7JE34UniRef Annotation by Michelle Graham. Most informative UniRef hit: EPIDERMAL PATTERNING FACTOR-like protein n=1 Tax=Medicago truncatula RepID=G7JE34_MEDTR SoyBaseE_val: 2.00E-32ISS
UniRef100_I1MU83UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MU83_SOYBN SoyBaseE_val: 3.00E-74ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g113800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g12260.1   sequence type=CDS   gene model=Glyma17g12260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCGCCAAAAGTATACCTCAATGGACTAAAAACTTCAGTGACTCTGATTCTCATAATTTCTCTCACGTTATTTCCTTCTAATTCAGTAGGGTCAGCTTCAGCGAAAGATGGTGGCAAGGTTCTGAAGCAAAAGAAATTAGTATTGGGGTCAAGGCCTCCAAAGTGTGTCAACAAGTGCTTGAGCTGCAAGCCATGCATGGCTGCTTTGGTTATCTCTCCTCACCACAGGGATGGTCACACTCACAAGGCAAAAACAGTTCAAAGAGACGAAGGCTACTATCTTCTCTCATGGAAATGCAAATGCGGTAACAAGTTCTTTCAGCCCTGA

>Glyma17g12260.1   sequence type=predicted peptide   gene model=Glyma17g12260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSPKVYLNGLKTSVTLILIISLTLFPSNSVGSASAKDGGKVLKQKKLVLGSRPPKCVNKCLSCKPCMAALVISPHHRDGHTHKAKTVQRDEGYYLLSWKCKCGNKFFQP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo