Glyma17g12150 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g12150

Feature Type:	gene_model
Chromosome:	Gm17
Start:	9188521
stop:	9189645
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g12150

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G26330	AT	Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein \| chr5:9241614-9242635 REVERSE LENGTH=187	SoyBase	E_val: 2.00E-28	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0042546	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis	SoyBase	N/A	ISS
GO:0044036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF02298	PFAM	Plastocyanin-like domain	JGI		ISS
UniRef100_G7JE55	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Blue copper protein n=1 Tax=Medicago truncatula RepID=G7JE55_MEDTR	SoyBase	E_val: 2.00E-57	ISS
UniRef100_I1MU72	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MU72_SOYBN	SoyBase	E_val: 2.00E-140	ISS

Expression Patterns of Glyma17g12150

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g12150

Paralog	Evidence	Comments
Glyma13g22650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g12150 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g112900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g12150

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g12150

Limit To All Plant Sequences

>Glyma17g12150.2   sequence type=CDS   gene model=Glyma17g12150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTTCAACGTCACAAGTTCTTACACCATAAGGAGAACAAGAAGAAAAAACCAACAAAAAAGATCTAGTCCTAGAATCCAACAGGGGCGACCTCACCTCCAAGAACACATAGCCATGTCAAGAAACTTGCTTCTTGTTCTTTTTGCAGTAGCCACCTTCCTCCATGGCTCAGAAGCACAAGCACCAGCACCAAAAGCCACTAGCCCCATTTCTCCACCAAGGTCTACACCAGCACCTGGCCCTTCCTCTGGATCAGTTACTTACACTGTTGGAGAGACTGCAGGCTGGATTGTTCCTGGCAACGCTTCCTTTTACCCAGCTTGGGCCTCTGCCAAAAACTTCAAGGTTGGAGACATCCTAGTTTTCAACTACCCATCAAATGCACACAACGTAGAGGAGGTGACAAAGGCCAACTACGATTCTTGCAGCTCAGCCTCTCCTATCGCCACTTTCACCACTCCACCGGCCAGAGTCCCCCTTAGCAAATCCGGTGAACATTACTACATCTGTGGAATTCCGGGGCACTGTTTGGGAGGACAAAAGCTTTCCATCAACGTCACCGGCGGCAGCACCGCCACCGCCCCCACCACTCCTTCTAGCCCTTCTCCATCAGGTGCTGTCAGTCCTCCCCCACAGAACTCTGCTGCTGCATCTCTCGGTCTTGTTGGAGTATCCGCCACCCTTCTTTCAGTTGCCGCGGCTTTTTTCTATTATTCTATTTATTAG

Predicted protein sequences of Glyma17g12150

Limit To All Plant Sequences

>Glyma17g12150.2   sequence type=predicted peptide   gene model=Glyma17g12150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFNVTSSYTIRRTRRKNQQKRSSPRIQQGRPHLQEHIAMSRNLLLVLFAVATFLHGSEAQAPAPKATSPISPPRSTPAPGPSSGSVTYTVGETAGWIVPGNASFYPAWASAKNFKVGDILVFNYPSNAHNVEEVTKANYDSCSSASPIATFTTPPARVPLSKSGEHYYICGIPGHCLGGQKLSINVTGGSTATAPTTPSSPSPSGAVSPPPQNSAAASLGLVGVSATLLSVAAAFFYYSIY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain