Report for Sequence Feature Glyma17g12040
Feature Type: gene_model
Chromosome: Gm17
Start: 9078459
stop: 9079741
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g12040
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G43290 AT
Annotation by Michelle Graham. TAIR10: Calcium-binding EF-hand family protein | chr2:17991308-17991955 REVERSE LENGTH=215
SoyBase E_val: 1.00E-43 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005509 GO-mf
Annotation by Michelle Graham. GO Molecular Function: calcium ion binding
SoyBase N/A ISS
KOG0027
KOG
Calmodulin and related proteins (EF-Hand superfamily)
JGI ISS
PTHR10891 Panther
CALMODULIN
JGI ISS
PTHR10891:SF141 Panther
CALCIUM-BINDING PROTEIN
JGI ISS
PF00036 PFAM
EF hand
JGI ISS
UniRef100_G7JFB5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin-like protein n=1 Tax=Medicago truncatula RepID=G7JFB5_MEDTR
SoyBase E_val: 1.00E-87 ISS
UniRef100_UPI000233E0B3 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233E0B3 related cluster n=1 Tax=unknown RepID=UPI000233E0B3
SoyBase E_val: 5.00E-163 ISS
Expression Patterns of Glyma17g12040
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma17g12040
Paralog Evidence Comments
Glyma13g22810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g12040 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g112000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g12040
Coding sequences of Glyma17g12040
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g12040.1 sequence type=CDS gene model=Glyma17g12040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATCTATCTACACTGTTGCTAGCTGTTCTCTTCATCGCAGGCCTCATTAATATTTTCTTTTACGTACCCACCACCAAGATTGGTGCGTGGCTTCAAACTTTCTTATTCCCCAACAACAATGCTTGCAACAAAACCAAAACCAACTTAGTTCCTTCTTCCTCTTCTTCACCAACGACCAAGGTGGAGAGTACTGGTTCCCAAAAGAAGAAGGAAGAGCTTAGAAAAGTGTTCTCCACTTTCGACAAAAACGGCGACGGATTCATAACGAAGCAGGAGCTGAGGGAGTCCCTGAGGAACATCAGAATCTTCATGACAGAACAAGAGGTCGATGATATTGTTGTCAAGTACGATTCCAACGGGGACGGGTTGATCGATTTTGAAGAGTTTTGCTTGTTGACTAGTGAGTGTGTAGGAGTGGATCATGAGAAAGAGGGTGATGGTGTTATTGAAAATGAAGAGGTTGATTTGAAGGAGGCTTTTGATGTGTTTGATAAAGATAATGATGGGCTTATTTCGGTGGAGGAGTTGGCTTTGGTGCTTACTTCGTTGGGACTAAGGGAAGGGAGAAAGATTGAAGAGTGCAAAGAGATGATTAAGAAGGTTGATATGGATGGAGATGGCATGGTCAATTTTAACGAGTTCAAGAGAATGATGATGAATGGAGGAAAGTTTTTCTTTAACGCATAA
Predicted protein sequences of Glyma17g12040
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g12040.1 sequence type=predicted peptide gene model=Glyma17g12040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDLSTLLLAVLFIAGLINIFFYVPTTKIGAWLQTFLFPNNNACNKTKTNLVPSSSSSPTTKVESTGSQKKKEELRKVFSTFDKNGDGFITKQELRESLRNIRIFMTEQEVDDIVVKYDSNGDGLIDFEEFCLLTSECVGVDHEKEGDGVIENEEVDLKEAFDVFDKDNDGLISVEELALVLTSLGLREGRKIEECKEMIKKVDMDGDGMVNFNEFKRMMMNGGKFFFNA*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
