SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g11990

Feature Type:gene_model
Chromosome:Gm17
Start:9025029
stop:9025482
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g11990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_I1LZQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZQ7_SOYBN SoyBaseE_val: 9.00E-14ISS

Expression Patterns of Glyma17g11990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g11990
ParalogEvidenceComments
Glyma13g22870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g11990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g11990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g11990
>Glyma17g11990.1   sequence type=CDS   gene model=Glyma17g11990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATATTGATTATTATAAGCAGGGCATTGATGAACTTATCGGTGAATTCATTGAGACCATTGAAAACATAAAGAACATACAAAAAGATAAGGAACTGATAGTAGATGTTGTGGAGAAGGTTGCTAATGACTGGCATGTCCAGAAACAAACAGGATTGGGGGACGATGGATATGAGAAGGAGTTCGAGCAATTACTTCTAGAGCAGCAACCACATGATAGAGATTCTAACCAAGTTTGA
Predicted protein sequences of Glyma17g11990
>Glyma17g11990.1   sequence type=predicted peptide   gene model=Glyma17g11990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNIDYYKQGIDELIGEFIETIENIKNIQKDKELIVDVVEKVANDWHVQKQTGLGDDGYEKEFEQLLLEQQPHDRDSNQV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo