SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g11940

Feature Type:gene_model
Chromosome:Gm17
Start:8985940
stop:8988187
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g11940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G10940AT Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr2:4311160-4312035 REVERSE LENGTH=291 SoyBaseE_val: 1.00E-44ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_I1MU53UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MU53_SOYBN SoyBaseE_val: 2.00E-123ISS
UniRef100_Q8VWX9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Extensin-like protein (Fragment) n=1 Tax=Cucumis sativus RepID=Q8VWX9_CUCSA SoyBaseE_val: 2.00E-43ISS

Expression Patterns of Glyma17g11940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g11940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g111100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g11940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g11940
>Glyma17g11940.1   sequence type=CDS   gene model=Glyma17g11940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTCCTCAAAGATCTATGCTTACCTCTTCCTCTGCATGATCTTTCTCTCTTCCGCCACTCCCATTCTCGGTTGTGGCTACTGTGGCAAACCCCCCAAAAAGCACAAGCCTGGTAAAACACCAAAGACACCCAAAACACCCGTTGTTAAGCCACCAGTCACCATCCCTCCCATTAATGTTCCTCCCGTTGTTCTTCCACCAATAGTGAAGCCCCCAGGTATTCTCCCTCCAATTCCAATTATTAACCCACCAACCACACCAGGGAAGGGAGGGAACACTCCATGCCCACCACCAAAGTCTCCTGCGCAGGCTACGTGCCCCATTGACACGCTCAAACTTGGTGCCTGTGTGGATCTTCTTGGAGGGTTGGTTCACATTGGTTTGGGTGACCCTGTTGCGAACCAGTGCTGCCCCGTGCTTCAAGGGCTTGTTGAGGTTGAAGCTGCGGTGTGTCTTTGCACCACTCTTAAACTGAAGCTTCTCAACCTCAACATTTATGTCCCACTTGCCCTTCAGCTCCTTGTGACTTGTGGCAAGTCTCCTCCTCCTGGTTACACGTGCTCCCTCTAA
Predicted protein sequences of Glyma17g11940
>Glyma17g11940.1   sequence type=predicted peptide   gene model=Glyma17g11940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESSKIYAYLFLCMIFLSSATPILGCGYCGKPPKKHKPGKTPKTPKTPVVKPPVTIPPINVPPVVLPPIVKPPGILPPIPIINPPTTPGKGGNTPCPPPKSPAQATCPIDTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVEVEAAVCLCTTLKLKLLNLNIYVPLALQLLVTCGKSPPPGYTCSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo