Glyma17g11730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g11730

Feature Type:	gene_model
Chromosome:	Gm17
Start:	8802554
stop:	8805434
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g11730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G60430	AT	Annotation by Michelle Graham. TAIR10: actin-related protein C3 \| chr1:22264797-22265682 REVERSE LENGTH=174	SoyBase	E_val: 5.00E-116	ISS
GO:0007015	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament organization	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0030833	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of actin filament polymerization	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005856	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton	SoyBase	N/A	ISS
GO:0005885	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Arp2/3 protein complex	SoyBase	N/A	ISS
GO:0005198	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural molecule activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG3155	KOG	Actin-related protein Arp2/3 complex, subunit ARPC3	JGI		ISS
PTHR12391	Panther	ARP2/3 COMPLEX 21 KD SUBUNIT-RELATED	JGI		ISS
PF04062	PFAM	ARP2/3 complex ARPC3 (21 kDa) subunit	JGI		ISS
UniRef100_I1MU29	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MU29_SOYBN	SoyBase	E_val: 6.00E-125	ISS
UniRef100_Q8LFW2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Contains similarity to 21 KD subunit of the Arp2/3 protein complex (ARC21) n=1 Tax=Arabidopsis thaliana RepID=Q8LFW2_ARATH	SoyBase	E_val: 8.00E-113	ISS

Expression Patterns of Glyma17g11730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g11730

Paralog	Evidence	Comments
Glyma13g23140	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g11730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g108800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g11730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g11730

Limit To All Plant Sequences

>Glyma17g11730.1   sequence type=CDS   gene model=Glyma17g11730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTATCACTCTAGTTTTGTGAATGAAGATGGAGTGAGTAGAGCATGTGGGTGCCCTCTTCTTCCTCTCAAGAGCCACATTAAGGGACCTGCTCCTGTTTCAGATCAAGACAGAACTGATATTGTGGATGAAGCCATAACCTTCTTCCGAGCCAATGTGTTCTTCAGAAACTTTGACATCAAGAGCCCTGCTGATAAGCTTCTCATATACTTGACCTTTTACATTAATGTTGCTCTCAAGAGGCTTGAAGGTTGCAGAACCTTGGCAGAAGGAACCAAGGCAATCATCAACTTGGGTCTCGAAAAGGTTCCTGTCCCTGGAGAGTCTGGCTTTCCATTTCCGGGCCTTTTCCCTCTTCCTCAATCACACAAGGAAGCAGAATTATTCAGAAATTATTTGAAGCAGATTAGGGAAGAAACAAGTGGGAGGTTACTGAGCGTTGCATACAGACCTAATGGCACTCCAAATAAATGGTGGTTGGCATTTGCAAAGAGAAAATTTATGAATATAATCATCCCTTGA

Predicted protein sequences of Glyma17g11730

Limit To All Plant Sequences

>Glyma17g11730.1   sequence type=predicted peptide   gene model=Glyma17g11730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVYHSSFVNEDGVSRACGCPLLPLKSHIKGPAPVSDQDRTDIVDEAITFFRANVFFRNFDIKSPADKLLIYLTFYINVALKRLEGCRTLAEGTKAIINLGLEKVPVPGESGFPFPGLFPLPQSHKEAELFRNYLKQIREETSGRLLSVAYRPNGTPNKWWLAFAKRKFMNIIIP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain