SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g11470

Feature Type:gene_model
Chromosome:Gm17
Start:8618110
stop:8620363
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g11470
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G12646AT Annotation by Michelle Graham. TAIR10: PLATZ transcription factor family protein | chr2:5167179-5169022 REVERSE LENGTH=256 SoyBaseE_val: 3.00E-119ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04640PFAM PLATZ transcription factor JGI ISS
UniRef100_G7JGM8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc-binding protein n=1 Tax=Medicago truncatula RepID=G7JGM8_MEDTR SoyBaseE_val: 6.00E-155ISS
UniRef100_I1MU06UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MU06_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma17g11470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g11470
ParalogEvidenceComments
Glyma13g23360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g11470 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g106300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g11470
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g11470
>Glyma17g11470.1   sequence type=CDS   gene model=Glyma17g11470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCATGGGATACCAAAAGCCTGCATGGTTGGAAGCTCTTTACACACAAAAGTTCTTCGTGGGGTGCTCTTACCATGAGAACGCTAAAAAGAATGAGAAGAATGTCTGCTGCTTAGATTGCTGCACCAGTATTTGTCCTCACTGCTTGCCATCTCATCGCTTCCACAGGCTTCTTCAGGTTCGCCGTTACGTTTATCATGATGTTGTTAGGTTGGAAGATCTTCAGAAACTCATAGATTGCTCCAACGTTCAGGCCTATACCATCAATAGTGCCAAGGTGGTGTTCATCAAGAAGAGACCTCAAAACCGGCAATTCAAAGGATCAGGAAACTACTGCACCTCCTGTGATAGAAGCCTCCAAGAGCCTTTTATCCATTGCTCCCTTGGATGCAAGGTGGATTTTGTTCTGAAACACTATAAGGACCTCTCTCCCTACTTGAGAACATGCAACTCCCTACAGCTAAGCCCTGACTTTTTGATCCCACAAGATATGGGGGATGAGGAAATGACTCGTTCTACCGTTGTGGATTGTGATGAACCAATGAGCTCATCTTCAGGTTCATCAGGGTCAGAGAATAACATGAGCATGAACATGGCTTGCACAGAGATCGTTAGGAAGAGGAGGAGTGGATGGAGCACTGTTTGTGCAAAATTCATGGCCAATAGCAATAAGGTTTCTGATGAAGACATGGCCATAAGCATGAGTAGAAGAAAAGGCATCCCTCATAGATCCCCTCTGTGTTAG
Predicted protein sequences of Glyma17g11470
>Glyma17g11470.1   sequence type=predicted peptide   gene model=Glyma17g11470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIMGYQKPAWLEALYTQKFFVGCSYHENAKKNEKNVCCLDCCTSICPHCLPSHRFHRLLQVRRYVYHDVVRLEDLQKLIDCSNVQAYTINSAKVVFIKKRPQNRQFKGSGNYCTSCDRSLQEPFIHCSLGCKVDFVLKHYKDLSPYLRTCNSLQLSPDFLIPQDMGDEEMTRSTVVDCDEPMSSSSGSSGSENNMSMNMACTEIVRKRRSGWSTVCAKFMANSNKVSDEDMAISMSRRKGIPHRSPLC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo