SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g11360

Feature Type:gene_model
Chromosome:Gm17
Start:8534211
stop:8534612
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g11360
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G35090AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:13358536-13359015 FORWARD LENGTH=159 SoyBaseE_val: 6.00E-11ISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0048610GO-bp Annotation by Michelle Graham. GO Biological Process: cellular process involved in reproduction SoyBaseN/AISS
GO:0048868GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube development SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
UniRef100_I1MTZ4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTZ4_SOYBN SoyBaseE_val: 2.00E-91ISS
UniRef100_Q8LM16UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q8LM16_ORYSJ SoyBaseE_val: 1.00E-06ISS

Expression Patterns of Glyma17g11360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g11360
ParalogEvidenceComments
Glyma13g22570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g11360 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g105200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g11360
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g11360
>Glyma17g11360.1   sequence type=CDS   gene model=Glyma17g11360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAAGAAGAATCGAATCCTGGATCCCCTCACTCTCTGAAGAACAGGCTCAGATTCTCTCTCTGCTTCTCGTGTTGCTTCCCTCATCACCAGCGCGTGAGGCCGAGAATCGTTCGAAGCGCGTCGCTCCACAACAAGCCACGCTCCACCGATTTCCCCTTCCCGCAACTCAAGGAAAAGTGCTGCAACTTCATCAACCGCATAGGCGGCCGCCACCGCCGCCGCCACTCCGCCGACTTCCACTACGACGCGCTCAGCTACGCGCTCAACTTCGAAGACTACGCCACCGCCGATGAGAGGCACGTGGACGAACTCAAGAGTTTCTCCGCCAGATTGCCGGCGTCTCCGCCGCCGAAAGTTTCGCCAACTTCCGCCGCAATCGCAATCGCCTCCGCGTGA
Predicted protein sequences of Glyma17g11360
>Glyma17g11360.1   sequence type=predicted peptide   gene model=Glyma17g11360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEEESNPGSPHSLKNRLRFSLCFSCCFPHHQRVRPRIVRSASLHNKPRSTDFPFPQLKEKCCNFINRIGGRHRRRHSADFHYDALSYALNFEDYATADERHVDELKSFSARLPASPPPKVSPTSAAIAIASA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo