Report for Sequence Feature Glyma17g11360
Feature Type: gene_model
Chromosome: Gm17
Start: 8534211
stop: 8534612
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g11360
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G35090 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:13358536-13359015 FORWARD LENGTH=159
SoyBase E_val: 6.00E-11 ISS
GO:0009827 GO-bp
Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification
SoyBase N/A ISS
GO:0009860 GO-bp
Annotation by Michelle Graham. GO Biological Process: pollen tube growth
SoyBase N/A ISS
GO:0048610 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular process involved in reproduction
SoyBase N/A ISS
GO:0048868 GO-bp
Annotation by Michelle Graham. GO Biological Process: pollen tube development
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
UniRef100_I1MTZ4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTZ4_SOYBN
SoyBase E_val: 2.00E-91 ISS
UniRef100_Q8LM16 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q8LM16_ORYSJ
SoyBase E_val: 1.00E-06 ISS
Expression Patterns of Glyma17g11360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g11360
Paralog Evidence Comments
Glyma13g22570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g11360 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g105200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g11360
Coding sequences of Glyma17g11360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g11360.1 sequence type=CDS gene model=Glyma17g11360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGGAAGAAGAATCGAATCCTGGATCCCCTCACTCTCTGAAGAACAGGCTCAGATTCTCTCTCTGCTTCTCGTGTTGCTTCCCTCATCACCAGCGCGTGAGGCCGAGAATCGTTCGAAGCGCGTCGCTCCACAACAAGCCACGCTCCACCGATTTCCCCTTCCCGCAACTCAAGGAAAAGTGCTGCAACTTCATCAACCGCATAGGCGGCCGCCACCGCCGCCGCCACTCCGCCGACTTCCACTACGACGCGCTCAGCTACGCGCTCAACTTCGAAGACTACGCCACCGCCGATGAGAGGCACGTGGACGAACTCAAGAGTTTCTCCGCCAGATTGCCGGCGTCTCCGCCGCCGAAAGTTTCGCCAACTTCCGCCGCAATCGCAATCGCCTCCGCGTGA
Predicted protein sequences of Glyma17g11360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g11360.1 sequence type=predicted peptide gene model=Glyma17g11360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAEEESNPGSPHSLKNRLRFSLCFSCCFPHHQRVRPRIVRSASLHNKPRSTDFPFPQLKEKCCNFINRIGGRHRRRHSADFHYDALSYALNFEDYATADERHVDELKSFSARLPASPPPKVSPTSAAIAIASA*